Abstract
Understanding of the effects of the backbone cyclization on the structure and dynamics of a protein is essential for using protein topology engineering to alter protein stability and function. Here we have determined, for the first time, the structure and dynamics of the linear and various circular constructs of the N-SH3 domain from protein c-Crk. These constructs differ in the length and amino acid composition of the cyclization region. The backbone cyclization was carried out using intein-mediated intramolecular chemical ligation between the juxtaposed N- and the C-termini. The structure and backbone dynamics studies were performed using solution NMR. Our data suggest that the backbone cyclization has little effect on the overall three-dimensional structure of the SH3 domain: besides the termini, only minor structural changes were found in the proximity of the cyclization region. In contrast to the structure, backbone dynamics are significantly affected by the cyclization. On the subnanosecond time scale, the backbone of all circular constructs on average appears more rigid than that of the linear SH3 domain; this effect is observed over the entire backbone and is not limited to the cyclization site. The backbone mobility of the circular constructs becomes less restricted with increasing length of the circularization loop. In addition, significant conformational exchange motions (on the sub-millisecond time scale) were found in the N-Src loop and in the adjacent β-strands in all circular constructs studied in this work. These effects of backbone cyclization on protein dynamics have potential implications for the stability of the protein fold and for ligand binding.
Introduction
Perturbation of protein structure by changing the polypeptide chain topology from a linear to a circular one is a promising tool for exploring the protein energy landscape in order to gain insights into mechanisms underlying protein stability and folding, and ultimately biological function. The backbone cyclization of a polypeptide chain, i.e., the ligation of its N- and C- termini via a peptide bond (hereafter called circularization) is expected to reduce the backbone conformational entropy, especially in the intermediate and unfolded state, thus potentially resulting in increased thermodynamic stability and backbone rigidity of the folded state (Iwai and Pluckthun, ). Although this fact is well known for peptides, and backbone cyclization has become a widely used strategy to control the structure and biological function of small peptides and to improve their in vivo stability (Hruby, ; Kessler, ; Hruby et al., ), the impact of backbone circularization in proteins has not been fully explored. Understanding the effect of backbone circularization on protein structure, dynamics, and function will provide insights into the role of the termini in protein stability, and lead to potential applications of backbone cyclization as a tool for rational drug design and protein engineering.
Many proteins in the cell have modular architecture, i.e., are composed of various individually folded domains, and the function and interactions of these units are central for the regulation of various events, including signal transduction and transcriptional control. Isolation of individual domains for structural and biochemical studies, a common “reductionist” approach in structural biology, takes them out of the context of the whole protein, and could result in increased flexibility of the termini by removing the restricting influence of the neighbors. This could alter the thermodynamic stability of the domains under study. Restricting the mobility of the termini by circularization can, to some extent, mimic the “natural” situation in multidomain proteins, and thus could be useful for understanding the effect of the “environmental” factors on the structure and function of individual domains in these systems.
For the backbone circularization of a folded protein to occur, the N- and C-termini have to be in close proximity. This prerequisite is a surprisingly common feature in protein folds, particularly in single protein domains (Thornton and Sibanda, 1983), and several naturally occurring cyclic gene products have been recently discovered (Trabi and Craik, 2002). The first successful semisynthesis of a circular protein was carried out by Creighton and Goldenberg by exposing native BPTI to a chemical cross-linking agent (Goldenberg and Creighton, ). Since then, several chemical (Camarero et al., ,; Tam and Lu, 1998; Deechongkit and Kelly, ) as well as recombinant techniques for in vitro (Camarero and Muir, ; Evans et al., , ; Iwai and Pluckthun, ; Scott et al., 1999) and in vivo (Scott et al., 1999; Camarero et al., ; Kimura et al., ; Young et al., 2011; Jagadish et al., ) cyclization have allowed access to circular proteins (Aboye and Camarero, ).
In some, but not all cases of known natural and synthetic cyclic proteins, the cyclization confers enhanced protease resistance, thermodynamic stability, and ligand binding affinity. While greater protease resistance could be anticipated, as the flexible termini often represent target points for attack of proteolytic enzymes, the effect of cyclization on protein structure and function is less obvious. Circular topology alone does not necessarily mean an increased thermodynamic stability of a protein (Matsumura and Matthews, 1991; Otzen and Fersht, 1998; Grantcharova et al., ), because the strain introduced by linking the termini could offset the favorable entropic contribution caused by circularization, and therefore could be a critical factor for the stability of a cyclic protein. This undesirable enthalpic effect could be reduced by increasing the length of the circularization loop, e.g., by inserting a flexible poly-Gly spacer at the ligation site (Martinez et al., 1999; Deechongkit and Kelly, ), however, the effect of the length of the insert on the overall protein stability is yet to be understood.
The thermodynamics, folding kinetics, and biological activity of different circular and linear c-Crk SH3 constructs has been already reported (Camarero et al., ). In this study, it was found that backbone cyclization of a truncated SH3 domain lacking the key Glu135 residue stabilizes the fold and restores the binding affinity for the C3G-based poly-Pro peptide ligand. Based on the magnitudes of the observed chemical shift perturbations in the backbone amides, it was assumed that the protein fold of the SH3 domain is not significantly altered by the circularization. However, direct structural verification of this hypothesis was missing. Atomic-resolution analyses of the structure and dynamics of the circular SH3 constructs are required in order to fully understand the effect of the circularization on the protein. Here we apply NMR methods to determine and compare in detail the structure and backbone dynamics of the linear and several circular SH3 constructs with varying length and amino acid composition of the circularization loop. Our results reveal the effect of backbone circularization on the structure and backbone dynamics of the N-Crk SH3 circularized protein domain.
Materials and methods
Analytical gradient HPLC was performed on a HP1100 series instrument with 220 and 280 nm detection. Analytical HPLC was performed on a Vydac C18 column (5 micron, 4.6 × 150 mm) at a flow rate of 1 mL/min. Semi-preparative HPLC was performed on a Beckman 110A DeltaPrep 4000 system fitted with a ISCO V4 tunable absorbance detector using a Vydac C18 column (15–20 micron, 15 × 250 mm) at a flow rate of 7 mL/min. All runs used linear gradients of 0.1% aqueous TFA (solvent A) vs. 90% acetonitrile plus 0.1% TFA (solvent B). Electrospray ionization mass spectrometry (ESI-MS) analysis was routinely applied to all proteins and components of reaction mixtures. ESI-MS was performed on a Sciex API-100 single quadrupole electrospray mass spectrometer. Calculated masses were obtained using the program MacProMass (Lee and Vemuri, 1990). Expressed proteins were routinely analyzed on SDS-PAGE using the standard procedures. The affinity constants of the circular and linear versions of the SH3 domain for ligand were measured using a fluorescence-based titration assay as described elsewhere (Camarero et al., ).
Cloning and expression of SH3lin−wt
The DNA encoding the c-Crk N-SH3 domain (residues A134-Y190) was isolated by PCR. The 5′ primer (5′-G ATT CTC AGG CAG CAT ATG GCA GAG TAT GTG CGG G-3′) encoded a NdeI restriction site and N-terminal Met, fused in frame with the SH3 N-terminus. The 3′ oligonucleotide (5′- GA TAC TGA CGC TCT TCC GCA TCC ATA CTT CTC CAC GTA AG-3′) introduced a C-terminal Gly as well as a SapI restriction site. The PCR amplified SH3 domain was purified, digested simultaneously with NdeI and SapI and then ligated into a NdeI-SapI-treated plasmid pTXB-1 (New England Biolabs). The resulting plasmid pTXB-1-SH3lin−wt was shown to be free of mutations in the c-Crk SH3-encoding region by DNA sequencing. Two liters of E. coli BL21(DE3)pLysS+ cells transformed with pTXB-1-SH3lin−wt plasmid were grown to mid-log phase (OD600 ≈ 0.6) in Luria-Bertani medium and induced with 0.5 mM IPTG at 37°C for 4 h. The lysate was clarified by centrifugation at 14,000 rpm for 30 min. The clarified supernatant (ca. 40 mL) was incubated with 5 mL of chitin-beads (New England Biolabs), previously equilibrated with column buffer (0.1 mM EDTA, 50 mM sodium phosphate, 250 mM NaCl, 0.1% Triton X-100 at pH 7.2), at 4°C for 30 min with gently shaking. The beads were extensively washed with column buffer (10 × 5 mL) and equilibrated with PBS (50 mM sodium phosphate, 100 mM NaCl at pH 7.2, 2 × 50 mL). The intein-fusion protein adsorbed on the beads was then cleaved by adding cysteamine (≈ 30 mM) for overnight at 25°C. The supernatant was separated by filtration and the beads were washed with additional PBS at pH 7.2 (4 × 5 mL). The supernatant and the washes were pooled, and the protein was purified by preparative HPLC using a linear gradient of 31–43% B over 30 min. The purified protein was characterized by ESI-MS (predicted: 6905.59 Da, measured: 6905.5 ± 0.04 Da). The isolated yield for purified SH3lin−wt was around 2 mg/L.
Cloning and expression of the circular constructs, SH3circ−Δ, SH3circ−GΔ, and SH3circ−wt
The DNA encoding the c-Crk N-SH3 domain was isolated by PCR as in the previous case. The 5′ primer encoded an Nde I restriction site and a N-terminal Met-Cys motif (Met-Cys for SH3circ−Δ, Met-Cys-Gly for SH3circ−GΔ and SH3circ−wt) fused in frame with the SH3 domain. The 3′ primer was same as in the cloning of the SH3lin−wt. The PCR product was subcloned into an Nde I/Sap I-treated plasmid pTXB-1 as described above. The resulting pTXB-1-SH3circ plasmid was shown to be free of mutations in the c-Crk SH3-coding region by DNA sequencing. The expression and purification of the intein-fusion protein was done as described for SH3lin−wt. The cyclization was carried out by treating the intein-fusion protein adsorbed on chitin beads with PBS at pH 7.2 containing 5% EtSH in volume for overnight at room temperature. Purification of the cyclic products was performed as described for SH3lin−wt. The purified proteins were characterized by ESI-MS (SH3circ−Δ: 6747.6 Da predicted, 6747.3 ± 1.3 Da measured; SH3circ−GΔ: 6803.6 Da predicted, 6804.5 ± 0.8 Da measured; SH3circ−wt.: 7003.7 Da predicted, 7002.88 ± 0.13 Da measured). The isolated yield for purified circular constructs was around 2 mg/L.
Expression of uniformly labeled 15N SH3 domains
Uniformly 15N labeled SH3 domains were obtained by growing the corresponding transformed BL21 E. coli cells in M9 minimal medium, supplemented with 0.2% glucose and 0.1% 15NH4Cl (99% enriched). The M9 was also supplemented with 100 mg/L ampicillin and 5 mg/L thiamin hydrochloride. The expression conditions were identical to those employed using Luria-Bertani medium, the expression yields using M9 medium were 60–70% of those mentioned above.
NMR experiments
Samples for the NMR studies were prepared by dissolving the protein (concentration ~1 mM) in the buffer containing 20 mM sodium phosphate, 100 mM NaCl, 20 mM DTT-d10, 10% D2O, and 0.2% NaN3. The pH was adjusted to 7.2. The NMR measurements were performed on Bruker DMX-500 and DRX-600 spectrometers operating at 1H resonance frequency of 500 and 600 MHz, respectively. The sample temperature was set to 34°C. NMR experiments performed for signal assignment and structure determination included 2D homonuclear DQF-COSY, TOCSY (90 ms mixing time), and NOESY (100 and 150 ms mixing time) and heteronuclear 1H−15N-HSQC. 15N relaxation studies included measurements of the longitudinal (R1) and transverse (R2) relaxation rates, and the heteronuclear 15N-{1H} steady state NOE, using the experimental approaches described elsewhere (Grzesiek and Bax, ; Fushman et al., ). The experiments were performed in an interleaved fashion as detailed elsewhere (Camarero et al., ; Hall and Fushman, ). The repetition delay between successive 180° pulses in the R2 experiments (CPMG) was 1 ms. In order to explore possible conformational exchange motions in SH3circ−GΔ on a slower time scale, we also performed transverse-relaxation compensated CPMG measurements (Loria et al., 1999) with the repetition delays of 1, 4, and 8 ms. In addition, for the SH3circ−GΔ sample, we measured the transverse cross-correlation rate η between 15N CSA and 1H-15N dipolar interaction using the method of Tjandra et al. (Tjandra et al., 1996) with the relaxation delay Δ set to 31.9, 42.6, and 53.2 ms. The η-values were uniformly scaled by 1.07, as described in Hall et al. (). Processing of the spectra was done using XWINNMR (Bruker). Further analysis including signal assignment, peak picking and integration for structure determination was done using XEASY (Bartels et al., ).
NMR signal assignment
The assignment of 1H and 15N resonances for each SH3 construct was carried out using a combination of homonuclear (TOCSY, COSY, and NOESY) and heteronuclear 1H-15N HSQC spectra. Published partial assignments for the wild type SH3 domain in the context of the c-Crk SH23 construct (Anafi et al., ) were used as a starting point for the spin system assignment. Nearly all backbone and side chain 1H and all 15N signals were assigned. No resonances could be reliably detected for Gly191 in SH3circ−Δ, for the Cys in the cyclization loop in the longer circular constructs (SH3circ−GΔ, SH3circ−wt), and for Asn146 in SH3circ−wt. Only one of the two glycines in the cyclization loop was observed in SH3circ−G Δ and SH3circ−wt. The splitting between Hα signals for this Gly was similar to that in Gly191 of SH3lin−wt, however, unambiguous assignment of this spin system to Gly191 or to Gly135 (SH3circ−GΔ)/Gly133 (SH3circ−GΔ) was not possible. The assignments of protons within aromatic rings were sometimes uncertain because of signal overlap. The stereospecific assignment of diastereotopic protons was not carried out.
Analysis of relaxation data
Relaxation data analysis including automatic peak picking and integration, relaxation curve fitting, and analysis of protein dynamics was performed using an in-house suite of Matlab programs PICK, RELAXFIT, DYNAMICS, R2R1 (Fushman et al., , ; Hall and Fushman, ; Fushman, ), and ROTDIFF (Walker et al., 2004). All analyses were based on measured peak intensities, the experimental uncertainties in peak intensities were estimated by integrating regions of spectra containing no cross peaks.
Structure calculation
Structure calculations were performed using program DYANA (Guentert et al., ). The NOE distance constraints for structure determination were obtained by integrating cross peaks in the NOESY spectra. The following procedure (resembling molecular replacement) was used to facilitate NOESY signal assignment after the spin system assignment was completed. Pairs of protons closer than 5 Å from each other were calculated based on the crystal structure of the wild type SH3 domain (Wu et al., 1995), and a list of predicted NOESY cross peaks was generated, using the chemical shifts from spin system assignment. This peak list was then loaded onto the NOESY spectrum and filtered, both visually and numerically (using automatic peak integration), to retain only reliably observed cross-peaks. This analysis was done using in-house written Matlab programs. The remaining unassigned/unpicked cross peaks, especially those between HN-HN, HN-Hα, and Hα-Hα, were manually picked and assigned using the NOAH procedure (Mumenthaler et al., 1997). The peaks that could be assigned were calibrated and included in final structure refinement. Depending on the construct, between 30 and 50 peaks were added using NOAH. The resulting NOE-peak list was then translated into distance constraints (upper limits) using the CALIBA procedure included in DYANA. In order to achieve the backbone cyclization in the structure calculations (in silico), we applied additional constraints between the corresponding atoms to obtain a trans peptide bond between the N- and C-termini. These include three upper limit constraints (N-C = 1.32 Å, N-O = 2.26 Å, HN-C = 2.06 Å) and one lower limit constraint, HN-O = 3.17 Å.
Results
As a model for these studies we have selected the N-terminal SH3 domain (57 residues long) of the adapter protein c-Crk (Knudsen et al., 1994). The structure of the free isolated SH3 domain was not available. According to the crystal structure of the SH3 domain complexed with a C3G-derived proline-rich peptide (Knudsen et al., 1994), the protein adopts a compact fold featuring five β-strands and a short 310-helix (Wu et al., 1995) (see Figure 1E). The native/folded state of SH3 is stabilized by a network of electrostatic and hydrophobic interactions. Specifically, the salt bridge between the side chains of residues Glu135 and Lys164 has been shown to be essential for the stability of the SH3 fold (Camarero et al., ). Although Glu135 does not belong to the secondary structure of the protein, its deletion destabilizes the SH3 structure, resulting in a partially unfolded protein (Camarero et al., ) with a ten-fold weaker affinity for the ligand. The juxtaposed N- and C-termini make this SH3 domain a favorable target for circularization.
Figure 1
Design of linear and circular constructs
In order to study the influence of backbone circularization on protein structure and backbone dynamics, we used three circular constructs of the SH3 domain and the linear full-length N-terminal c-Crk SH3 as a control (Table 1). The amino acid sequence of the linear construct, SH3lin−wt, comprised residues 134–190 from the wild type N-terminal SH3 domain of c-Crk, with an additional Gly191 added at the C-terminus. Residues 136–191 from SH3lin−wt were preserved in all circular SH3 constructs, the only difference in the sequence was in the length and the composition of the circularization region, i.e., in the amino acids inserted N-terminal to Tyr136. Amino acid sequences of all circular constructs contained an N-terminal Cys inserted for the circularization purposes. SH3circ−Δ was the shortestconstruct, with residues Ala134 and Glu135 deleted. SH3circ−GΔ contained an additional Gly inserted in the cyclization loop; this construct had the same number of amino acids as the linear construct SH3lin−wt but lacked residues Ala134 and Glu135. SH3circ−wt had the same sequence as the wild type linear construct, with an additional Cys-Gly pair inserted at the N-terminus. These circular constructs were designed to examine how the length of the circularization region and the interactions associated with Glu135 affect the structure and dynamics of the circular SH3 domain. A comparison of SH3circ−GΔ vs. SH3circ−Δ addresses the effect of increasing the length of the cyclization loop by one Gly, further emphasized by SH3circ−wt with a 3-residue longer cyclization loop than in SH3circ−Δ. A comparison of SH3circ−GΔ vs. SH3lin−wt shows the effect of cyclization in the absence of Glu135, and SH3circ−wt vs. SH3lin−wt the effect of cyclization in the presence of Glu135.
Table 1
| Construct | Sequencea |
|---|---|
| 136 191 | |
| SH3circ-Δ | cyclo-[C - - - YVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG] |
| SH3circ-GΔ | cyclo-[CG - - YVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG] |
| SH3circ-wtb | cyclo-[CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG] |
| SH3lin-wt | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG |
Amino acid sequence and notations for the various SH3 domain constructs used in this study.
The residue numbering corresponds to the full-length murine c-Crk sequence. The N-terminal Cys is not from the native sequence—it is included in the sequence for the circularization purposes (Camarero et al., ).
Note that the SH3circ-wt construct here is different from that (Crkcirc-wt) used in our previous study (Camarero et al., ): an insertion of an additional Gly in the circularization loop resulted in a significant increase in the yield of the cyclization reaction. That construct also showed chemical shift positions similar to those in the linear wt SH3 domain (SH3lin-wt).
Generation of linear and circular constructs
The linear recombinant SH3lin−wt was prepared by using a modified Mxe GyrA intein fusion protein as described in Materials and Methods. All the circular SH3 constructs were obtained recombinantly by using an intein-mediated intramolecular native chemical ligation reaction (Camarero and Muir, ; Camarero et al., ,). Briefly, the corresponding SH3 linear precursors were cloned in frame to the N-terminus of a modified Gyrase A intein. The fusion proteins were also modified at the DNA level in order to introduce an N-terminal Met-Cys-(Gly) motif as well as a Gly residue at the C-terminus of all the circular SH3 constructs. The cysteine was required to facilitate the intramolecular native chemical ligation and the glycines were added to help alleviate strain caused by the circularization (Iwakura and Nakamura, ) and to explore the effect of the linker length. As reported earlier (Camarero et al., ), the Met residue is efficiently removed in vivo by the endogenous methionine aminopeptidase resulting in the generation of the N-terminal Cys motif in the intein-fusion protein. Note that no in vivo cyclization of the corresponding N-terminal Cys SH3-intein fusion proteins was observed here when using the modified Mxe GyrA intein, in contrast with the previous approach using the Sce VMA intein (Camarero et al., ). In all the SH3 constructs the resulting N-terminal Cys fusion proteins were stable in vivo. A detailed account of the difference in reactivity of the VMA vs. the Gyrase A inteins is beyond the scope of this paper and will be reported elsewhere.
Characterization of the circular SH3 constructs
The molecular weights of the linear and circular constructs were confirmed by ESI-MS. Their binding affinities for the C3G-based poly-Pro ligand were determined using a fluorescence-based binding assay as previously described (Camarero et al., ). The measured Kd values were 0.87 ± 0.06 μM (SH3lin−wt), 0.89 ± 0.12 μM (SH3circ−wt), 0.43 ± 0.02 μM (SH3circ−Δ), and 0.47 ± 0.05 μM (SH3circ−GΔ), in total agreement with the values published in the literature (Knudsen et al., 1994; Camarero et al., ). These assays confirmed that the circular SH3 constructs created here are functionally active.
Comparison of chemical shifts and β-strand alignment in the linear and circular SH3 domains
According to backbone 1H T2 values (T2 ~ 55–60 ms) and the overall rotational correlation time derived from 15N relaxation measurements (see below), all the SH3 constructs were present as monomers in solution. The characteristic NMR-fingerprint region (1H-15N HSQC) for all SH3 constructs studied here shows a common single set of well-spread cross peaks corresponding to a single folded conformation.
Chemical shift is a sensitive indicator of changes in the electron environment (hence in local structure) of a nucleus under observation. The comparison of 15N, 1HN, and 1Hα chemical shifts in the circular constructs vs. SH3lin−wt (Figure 2) shows, as expected, some chemical shift differences for the residues in and immediately adjacent to the cyclization region. Tyr136 and Tyr190 are of particular interest here: involved in hydrogen bonding between the β5- and the β1-strands there residues are located at the edges of the strands, bordering the newly formed cyclization loop (Figure 3). A comparison of the magnitudes and directions of the shifts in 15N and 1HN resonance frequencies for Tyr190 in all the SH3 constructs revealed an increase in the deshielding effect from SH3circ−wt to SH3lin−wt to SH3circ−GΔ and then to SH3circ−Δ suggesting an increase in the stability of the hydrogen bond between the amide of Tyr190 and carbonyl of Tyr136 in these constructs. Even stronger chemical shift changes are observed in Tyr136; however, their interpretation is less straightforward, because of the additional effect of the change in the identity of the neighboring (N-terminal) residue. In addition, strong perturbations are observed in Leu159 -Arg162 (strand β2). These sites are located in close spatial proximity to the N-terminus and make several hydrogen bonds with the β1-strand, most notable between the amide of Lys161 and the carbonyl oxygen of residue 135 (Figure 3). The observed perturbations likely reflect some local structural rearrangements upon circularization. Except for these two regions, the overall similarity of the observed chemical shifts in the rest of the sequence indicates that the overall fold of the SH3 domain is preserved upon circularization.
Figure 2
Figure 3
To further confirm these observations and to compare the protein structure in solution with that of the ligand-bound form in crystals (Wu et al., 1995), we determined the alignment of the β-strands based on the characteristic inter-strand NOE patterns (Figure 3). The assignment of the elements of secondary structure (β-strands) was based on the crystal structure and verified using characteristic secondary shifts for the amide 1H and 15N (Braun et al., ). For all constructs, we observed the characteristic NOEs, with minor exceptions of some residues close to the circularization region. Overall, the alignment of the β-strands obtained from the NOESY spectra is similar for all the SH3 constructs considered here and is in good agreement with that in the crystal structure (Wu et al., 1995). Based on these data, we included the corresponding hydrogen bonds between the β-strands and characteristic values (Wuthrich, 1986) for the ϕ-angles (with 30° tolerance) for the residues in the β-strands as additional restraints for the structure calculation (Table 2).
Table 2
| Distance constraints | SH3circ-Δ | SH3circ-GΔ | SH3circ-wt | SH3lin-wt |
|---|---|---|---|---|
| Intra-residuea | 325 | 397 | 362 | 356 |
| Short range (r = 1)a | 238 | 239 | 203 | 247 |
| Medium range (1< r < 5)a | 102 | 101 | 78 | 93 |
| Long range (r = 5)a | 328 | 317 | 270 | 323 |
| Total NOE constraints | 993 | 1054 | 913 | 1019 |
| Hydrogen bonds | 18 | 18 | 18 | 18 |
| Dihedral angle constraints | 25 | 25 | 25 | 25 |
| RMSD (resid. 137–189), Å | 0.90 ± 0.28 | 1.06 ± 0.24 | 1.14 ± 0.36 | 0.90 ± 0.27 |
| RMSD (coreb), Å | 0.28 ± 0.07 | 0.40 ± 0.10 | 0.35 ± 0.08 | 0.41 ± 0.10 |
| Target function | 7.4 ± 0.4 | 4.7 ± 0.2 | 5.3 ± 0.3 | 5.8 ± 0.5 |
Statistics of the NOE distance constraints used for the structure calculations and of the calculated ensembles of 20 lowest-target-function structures, for each protein construct.
Shown is the classification of the NOE constraints into intra-residual, short range, medium range, and long range for the final redundant dihedral angle constraints (REDAC) calculation (200 structures). Here r indicates the distance in the protein sequence between the corresponding residues.
The protein core was defined here as comprising residues 137–140 (β1), 157–164 (β2), 169–174 (β3), and 179–189 (β4, 310, β5) that belong to the secondary structure elements (indicated) in the SH3 domain.
Solution structures of the linear and circular forms of the SH3 domain
Three-dimensional structures for each SH3 domain construct were calculated based on the experimental distance (NOEs) and dihedral angle constraints, summarized in Table 2. Figure 1 depicts the three-dimensional properties of the ensembles of 20 lowest-target-function structures calculated for each SH3 construct using DYANA program (Guentert et al., ).
All derived solution structures are characterized by a well-defined protein core, formed by five β-strands and a short, one-turn 310 helix. The long β1/β2 loop (residues 141–156) is disordered, although it has some tendency to form a β-sheet like structure in the stem part (Phe141–Asn144 and Asp150–Lys155). In agreement with these data, our backbone dynamics analysis (see below) indicates that only part of this loop is flexible. In addition, some flexibility-related disorder is observed in the β2/β3 and β3/β4 turns, as inferred from the higher RMSDs and lower order parameters in these regions. The backbone RMSDs (residues 137–189) for the ensemble of 20 structures, when compared to the crystal structure (Wu et al., 1995), range from 0.90 Å for SH3circ−wt and SH3circ−Δ to 1.14 Å for the SH3circ−GΔ construct. If only core residues are taken for the alignment (thus excluding flexible loops), the RMSDs are significantly lower, and range from 0.28 Å for SH3circ−Δ to 0.41 Å for the linear protein.
The quality of the derived NMR structures for every construct was also assessed using PROCHECK_NMR. If we exclude the flexible loop, nearly 100% of the structures for every construct show residues in the most favored (α- and β-structures) and additional allowed regions of the Ramachandran plot. The dihedral angles for residues 136–139, 157–161, 163, 169–174, and 178–183 of almost all structures are in the β-region. In the α-region we observe, for example, residues 165–168, 175–176, and 184–186, which form a short 310-helix (or type-III β-turn).
Backbone dynamics
In order to characterize the effect of circularization on the backbone dynamics of the SH3 domain, we measured 15N relaxation rates, R1 and R2, and the steady-state {1H}-15N NOE, as detailed in the Materials and Methods section. 48 to 50 well-resolved cross peaks from backbone amides were observed in the 1H-15N correlation maps. The relaxation data (Figure 4) are similar for most of the backbone amides in all SH3 constructs, suggesting that the subnanosecond backbone dynamics, by and large, are not significantly affected by the circularization. The rates of transverse relaxation show an interesting behavior. In all circular constructs, we observed elevated R2 values for the residues Glu166-Gln168 and Ala172 (in the β2/β3 loop and in the adjacent residues in the β2 and β3 strands), suggesting the presence of conformational exchange in this part of the backbone.
Figure 4
The backbone dynamics were characterized using the “model-free” approach (Lipari and Szabo, 1982). The overall tumbling of the protein was assumed isotropic, as suggested by the ratio (1.00:1.07:1.14) of the inertia tensor components. The model-free analysis of 15N relaxation data performed using our program DYNAMICS (Fushman et al., ; Hall and Fushman, , ; Fushman, ) yielded the following values of the overall tumbling time τc: 3.31 ns (SH3lin−wt), 3.26 ns (SH3circ−Δ, 3.11 ns (SH3circ −GΔ) for 500 MHz and 3.18 ns (SH3lin−wt), 3.00 ns (SH3circ−wt), 3.06 ns (SH3circ−GΔ) for 600 MHz data. The corresponding values derived directly from the R2/R1 ratio (Fushman et al., ) were 3.33 ± 0.13 ns (SH3lin−wt), 3.50 ± 0.28 ns (SH3circ−Δ, 3.20 ± 0.34 ns (SH3circ−GΔ) for 500 MHz and 3.16 ± 0.17 ns (SH3lin−wt), 2.99 ± 0.13 ns (SH3circ−wt), 3.22 ± 0.33 ns (SH3circ−GΔ) for 600 MHz data. These numbers are similar, within the experimental errors; the variation in the τc values most likely reflects small differences in temperature settings between the experiments and/or between the spectrometers.
The model-free parameters derived from the 15N relaxation data are shown in Figure 5. The squared order parameter values, S2, ranging from 0.8 to 0.95, are characteristic for restricted backbone dynamics in the core of a well-folded protein. The overall pattern of higher and lower values of the order parameter is similar for all constructs, reflecting the location of the residues in the protein core or in the flexible/unstructured loops. Lower values of S2 in the β1/β2, β2/β3, and β3/β4 loops indicate greater flexibility in these regions of the structure. The termini are highly flexible in the linear construct. As expected, their flexibility is significantly reduced upon circularization in the short circular construct (SH3circ−Δ), as indicated by the high value (0.86) of S2 for Cys135.
Figure 5
It is worth mentioning that the extended β1/β2 loop (the so-called RT-loop), typical for the SH3 fold, is not fully disordered. Particularly, the backbone dynamics in its C-terminal part (residues 152–157) are characterized by relatively high order parameters, which are comparable to those in the secondary structure elements. This observation is also consistent with the calculated ensembles of NMR structures (see above) that indicate a relatively well-defined backbone conformation in these residues.
Significant conformational exchange contributions (Rex) were observed in the β2/β3 loop and in the adjacent β-strands (Figure 5) in the circular constructs. In order to independently verify that these Rex terms derived using model-free analysis indeed correspond to conformational exchange, we also measured the transverse cross-correlation term, η, between 15N CSA and 1H-15N dipolar interaction. As pointed out elsewhere (Fushman and Cowburn, , ), η depends on the same combination of the spectral densities as R2' (which is R2 modified by subtracting high-frequency contributions (Fushman et al., ) but does not contain the Rex term. A linear dependence between η and R2' is, therefore, expected in the absence of conformational exchange. The plot in Figure 6 clearly identifies residues with significant Rex contribution as those shifted to the right of the average linear dependence of η vs. R2'. These results are in excellent agreement, both qualitatively and quantitatively, with the model-free analysis (Figure 5). The Rex values measured here reflect conformational exchange motions on a sub-millisecond time scale. No additional conformational exchange was observed in a slower time range, from 1 to 8 ms.
Figure 6
Discussion
In a previous study we showed that Glu135 is essential for the stability and ligand binding of the linear Crk N-terminal SH3 domain (Camarero et al.,
The effect of the circularization on the SH3 domain structure
Our chemical shift data and structure calculations both indicate that structural perturbations in the SH3 domain caused by circularization are small. Figure 7 presents a superposition of the three-dimensional structures of all SH3 constructs studied here and of the crystal structure of linear SH3 in the bound form. The backbone fold is very similar in all these SH3 constructs; the pair-wise RMSDs between the mean NMR structures (for each NMR ensemble) are 0.8–1.1 Å and reduce to 0.3–0.6 Å if only core residues are considered (Table 3). As expected, the termini in the linear protein are disordered, especially in comparison with the short circular construct, SH3circ−Δ, which forms a relatively rigid loop/turn (Figures 3A,B). This correlates with the observed higher order parameters for the “terminal” residues in SH3circ−Δ vs. SH3lin−wt. The observed chemical shift for Tyr190 HN in SH3circ−Δ suggests a higher tendency for hydrogen bonding to Tyr136, which further stabilizes contacts between the β5- and β1-strands. The circularization regions in SH3circ−GΔ and SH3circ−wt contain additional residues and, therefore, are more flexible than in SH3circ−Δ (Figures 3C,D). The structural similarity between the linear and circular SH3 constructs is also consistent with the fact (see above and Camarero et al.,
Figure 7

Comparison of the 3D structure of the backbone for the circular SH3 constructs with the solution and the (ligand-bound) crystal (Wu et al., 1995) structures for the linear domain. The solution structures are represented by the mean structure for each ensemble, colored green (SH3lin-wt), cyan (SH3circ-Δ), blue (SH3circ-GΔ), and yellow (SH3circ-wt). The crystal structure is colored red. These structures were superimposed using backbone heavy atoms for the core residues. The two panels represent two different orientations of the protein: (A) similar to that in Figure 1 and (B) view from the bottom. Elements or secondary structure and the termini are indicated. The drawings were made using InsightII.
Table 3
| SH3circ-Δ | SH3circ-GΔ | SH3circ-wt | SH3lin-wt | SH3crystal | |
|---|---|---|---|---|---|
| SH3circ-Δ | – | 0.91 | 0.81 | 1.01 | 1.11 |
| SH3circ-GΔ | 0.57 | – | 0.81 | 1.07 | 1.05 |
| SH3circ-wt | 0.56 | 0.33 | – | 0.83 | 1.11 |
| SH3lin-wt | 0.64 | 0.50 | 0.48 | – | 1.45 |
| SH3crystal | 0.78 | 0.65 | 0.63 | 0.70 | – |
Pairwise RMSD comparison between the three-dimensional structures of the linear and circular forms of the SH3 domain.
For this comparison, each construct was represented by the mean structure calculated for the ensembles of 20 lowest target function structures. A comparison with the crystal structure of the (linear) SH3 domain (Wu et al., 1995) is also included. The RMSD values (in Å) were calculated for the backbone heavy atoms; the numbers above the diagonal represent the RMSD values for the whole backbone (residues 137–189), while those below the diagonal correspond to the core residues (137–140, 157–164, 169–174, 179–189). The residues in the terminal regions or circularization loop were not included.
The main structural differences between the linear and circular constructs are found in the circularization region and in the spatially proximal sites located in the β2 strand (Figure 7). These results are fully consistent with the observed chemical shift perturbations. For example, the resonance frequency for Ile161 HN is shifted upfield in SH3circ−GΔ, while in SH3circ−wt and SH3circ−Δ it is shifted downfield compared to SH3lin−wt (Figure 2). According to the crystal structure, the amide group of Ile161 forms a hydrogen bond with the carbonyl of residue 135. In the calculated structure of SH3circ−GΔ, the hydrogen bond is less populated (5 out of 20 structures), partially because of the somewhat greater distance between the β1 and β2 strands, and partially due to greater conformational flexibility of the Gly residue in the position 135 in this construct. This causes an upfield shift in HN of Ile161, because of the weaker deshielding effect of the carbonyl group. In the other circular construct, SH3circ−wt, the hydrogen bond is formed in all structures, and the associated stronger deshielding effect is responsible for the downfield shift in HN of Ile161 compared to SH3lin−wt where the hydrogen bond is present in 17 out of 20 structures. Increased backbone rigidity in SH3circ−wt (Figure 8C) could also contribute to a greater stability of this hydrogen bond.
Figure 8

Differences in the NH contributions to backbone entropy between the linear and circular SH3 constructs, on a per residue basis. (A) SH3lin-wt – SH3circ-Δ; (B) SH3lin-wt – SH3circ-GΔ; and (C) SH3lin-wt – SH3circ-wt.
The effect of circularization on the backbone dynamics
In contrast to the structural data showing overall similarity in the protein fold, our analysis of the backbone dynamics revealed significant differences among the SH3 constructs. The backbone dynamics accessible by NMR relaxation cover fast, ps-ns motions and slower, μs-ms processes associated with conformational exchange. We consider the effect of backbone circularization on these two types of motion separately.
Fast Motions—Order Parameters
In order to quantify the differences in the backbone mobility between the linear and circular constructs, we calculated the associated changes in the backbone entropy, summarized in Figure 8 and Table 4. As shown in Li et al. (1996), Yang and Kay (1996), the differences in the order parameters can be related to the changes in the local contribution to conformational entropy of a protein (see also Akke et al.,
Table 4
| SH3 constructs | Full backbone without terminib | Core residues onlyc |
|---|---|---|
| 500 MHz | ||
| SH3lin-wt—SH3circ-Δa | 7.62 (1.24) | 3.58 (0.64) |
| SH3lin-wt—SH3circ-GΔ | 2.88 (0.32)d | 1.59 (0.21) |
| SH3circ-GΔ—SH3circ-Δ | 4.55 (1.24)d | 1.99 (0.64) |
| 600 MHz | ||
| SH3lin-wt—SH3circ-wt | 5.60 (0.62) | 2.72 (0.44) |
| SH3lin-wt—SH3circ-GΔ | 3.49 (0.61) | 1.63 (0.40) |
| SH3circ-GΔ—SH3circ-wt | 2.12 (0.59) | 1.09 (0.44) |
Differences in the backbone entropy between the SH3 constructs studied here.
The numbers correspond to ΔS/kB; numbers in the parentheses represent standard deviations of the observed distribution of values.
The difference in the entropy between constructs A and B for NH bond i was computed according to Yang and Kay (1996) as: where SAi and SBi are the order parameters for the NH bond in constructs A and B, respectively, and kB is the Boltzmann constant.
Residues 136–190; residues 145, 147, 154, 155, 164, and 176 were excluded due to overlap.
Residues 137–140, 157–163, 169–174, 179–189.
In addition to b, Tyr136 was excluded (SH3circ-GΔ) due to inconsistency in the S2 values derived at the two fields.
Overall, the backbone flexibility on the subnanosecond time scale is more restricted in the shorter circular constructs, and approaches that of the linear protein as the length of the circularization loop increases. Interestingly, this effect is not limited to the N- and C-termini and/or residues adjacent to the cyclization site, where a reduction in the conformational flexibility is expected. Our data (Figure 8, Table 4) indicate that small but systematic decrease in the amplitudes of the backbone motion in the circular constructs is present over the entire backbone.
Slow Motions—Conformational Exchange
The most striking difference observed here between the circular and linear constructs is in the slower, microsecond-time dynamics. The analysis indicates significant conformational exchange terms for Ile161, Asp163, Glu166, Glu167, Gln168, and Ala172 in the circular constructs (Figures 5, 6), as anticipated from the elevated R2 values (Figure 4). These residues are located in the β2/β3 loop (also known as the N-Src loop) and in the adjacent parts of the β2 and β3 strands (Figure 3), most of them in close proximity to the circularization region. Note that Pro165 was not observed, and the signal from Lys164 was exchange-broadened but could not be reliably quantified due to spectral overlap. The pattern of residues exhibiting conformational exchange motions is very similar for all circular constructs, and in SH3circ−GΔ for both 500 and 600 MHz data. Interestingly, the Rex contributions are most pronounced in the shorter circular constructs, SH3circ−Δ and SH3circ−GΔ, where the observed Rex values are almost identical. The exchange broadening is approximately three-fold weaker in SH3circ−wt and is further reduced in the linear construct.
What is the nature of this phenomenon? It is likely that the observed increase in the exchange broadening reflects the presence of slow rearrangements relieving a circularization-induced strain in the protein structure. Structural comparison of the linear and circular constructs (Figure 7) indicates that a displacement of the β1 strand as a result of the circularization causes a rearrangement in the proximal β2 strand that further propagates to β3 strand, thus also affecting the β2/β3 loop. Consistent with this model, the number of sites exhibiting conformational exchange is the largest in the shortest circular construct (SH3circ−Δ, Figure 5C) and it becomes smaller (as do the Rex values) with increasing length of the circularization loop. Interestingly, according to “mechanistic”-model calculations (Klimov and Thirumalai, 2002), β2/β3 is the stiffest loop in the c-Crk SH3 domain, in contrast to many other SH3 domains, where the so-called distal loop, β3/β4, has the highest stiffness. In addition, the number of native contacts between the strands β2 and β3 is higher than in the other strands in this protein. Also, tight packing of the aliphatic part of Lys164 side chain (β2 strand) against the indole ring of Trp170 (β3 strand) acts as a “staple” holding the two strands together, thus contributing to the stiffness of the β2/β3 hairpin. It is therefore plausible that the observed increased conformational exchange in this β-hairpin is due to its relative stiffness and is caused by the cyclization-induced strain that cannot be fully reduced by immediate minor structural rearrangements as, for example, in the other, less rigid parts of the structure.
Note also the presence of exchange broadening in some of the β2/β3 sites already in the linear SH3 (although significantly weaker than in the circular constructs). This suggests that the conformational exchange motions observed in these residues are significantly amplified but might not all be directly caused by the circularization. A possible source of the exchange broadening could be mutual rearrangement of the charged side chains of Glu135, Lys164, Glu166, Glu167, and possibly Lys189, resulting in slow NH bond motions or via an indirect effect of chemical shift modulation caused by changing electrostatic fields (Wang et al., 2001).
Structural basis for the stability of the SH3 domain fold
It has been suggested earlier (Grantcharova et al.,
The chemical shift positions for the ε-hydrogens of Lys164 show small but systematic differences between Glu135-deficient constructs (SH3circ−Δ, SH3circ−GΔ: Hε are at 2.09/2.08 ppm) and those (SH3circ−wt, SH3lin−wt: Hε are at 1.97/2.03 ppm) where Glu135 is present. This supports the suggested formation of a salt-bridge between Glu135 and Lys164. The presence of a hydrogen bond between Glu135 and Ile161 is also supported by our chemical shift data, as discussed above.
The effect of the length and composition of the cyclization loop on the backbone dynamics, protein stability, and ligand binding
All circular SH3 constructs studied here had in common the amino acid sequence from Tyr136 to Tyr191 of the c-Crk protein. This allowed us to examine the effect of the length and the composition of the cyclization loop. According to the data presented above, none of these variables has dramatic effect on the protein structure. There is, however, a small but distinct effect on the sub-nanosecond dynamics of the backbone. Overall, the backbone in the circular constructs appears more rigid than in the linear WT SH3 (Figure 8, Table 4). The backbone mobility appears most restricted in the shortest circular construct, SH3circ−Δ. Increasing the length of the circularization loop leads to an increase in the backbone mobility (hence entropy) (Table 4), which is the highest in the linear construct. Interestingly, the backbone in SH3circ−wt is slightly more rigid than in SH3circ−GΔ although the former construct has a two-residue-longer circularization loop. This is likely due to additional interactions caused by the presence of Glu135 that forms a salt bridge with the side chain of Lys164 (see above).
The length of the circularization loop has a more dramatic effect on the slow (ms-μs) motions (Figure 5) in that strong conformational exchange terms observed in the shorter circular constructs are markedly weaker in SH3circ−wt. Interestingly, SH3circ−Δ and SH3circ−GΔ have very similar patterns/values of Rex contributions and bind the ligand with similar affinity constants which are two-fold higher than for SH3lin−wt or SH3circ−wt. This suggests that the conformational exchange observed in this study could play role in ligand binding. In support of this hypothesis, the strongest conformational exchange contributions are observed in Glu166-Gln168. According to the crystal structure of the SH3-ligand complex (Wu et al., 1995), these residues are directly involved in interactions with the ligand. The carboxyl group of Glu167 makes a direct salt bridge contact with the ε-amino group of Lys9 of the ligand, while the side chain carboxyl group of Glu166 is properly positioned for hydrogen bonding with the amide group of the same residue. Moreover, the indole group of Trp169 is well packed against the aliphatic component of the ligand residue Lys8, one of the critical residues for C3G peptide binding to Crk SH3 (Knudsen et al., 1995). As a result, the ε-amino group of Lys8 is positioned such that it can reach and form a salt bridge with the carboxyl groups of Asp147, Glu149, and Asp150 located in the middle of the RT-loop of SH3. It is possible that the conformational exchange in the β2/β3 (N-Src) loop may help facilitate structural rearrangements necessary to accommodate these interactions. The energies associated with this effect are relatively weak (ΔG ≈ 0.4 kcal/mol), given the modest increase in the affinity constant in the short circular constructs. Further studies are required in order to understand the effect of backbone cyclization on ligand binding.
A previous study showed that the circularization of the SH3 domain does not significantly increase its thermodynamic stability (Camarero et al.,
Conclusions
We determined the three-dimensional structure and backbone dynamics of a linear and several circular forms of the N-terminal SH3 domain of c-Crk in order to examine the effect of backbone circularization. Our structural data indicate that the protein fold is not significantly affected by the backbone circularization. The protein dynamics, on the contrary, turned out to be sensitive to these modifications. Specifically, in addition to restricted mobility of the termini, we observed small but systematic reduction in the amplitudes of subnanosecond motions in the entire backbone, indicating increased backbone rigidity and lower conformational entropy. Intriguingly, this effect was observed over the entire backbone and was not limited to the cyclization site. In addition, the cyclization of SH3 resulted in significant conformational exchange motions on a μs-ms time scale in the β2/β3-region, likely due to the strain introduced by the circularization. These motions could be related to higher binding affinities of the shorter circular constructs. In summary, the experimental evidence from this and previous work indicates that unfavorable enthalpic effects can offset any favorable entropic effect as a result of the backbone cyclization process.
Atom coordinates
The atom coordinates for the SH3 domain constructs studied here have been deposited with the Protein Data Bank, the PDB accession numbers are 1M30 (SH3lin−wt), 1M3A (SH3circ−Δ, 1M3B (SH3circ−GΔ), and 1M3C (SH3circ−wt).
Conflict of interest statement
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Statements
Acknowledgments
Supported by NIH grants GM065334 (to DF) and GM090323 (to JC) FS acknowledges the fellowship from Deutsche Forschungsgemeinschaft (DFG).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
AboyeT. L.CamareroJ. A. (2012). Biological synthesis of circular polypeptides. J. Biol. Chem. 287, 27026–27032. 10.1074/jbc.R111.305508
2
AkkeM.BruschweilerR.PalmerA. (1993). NMR order parameters and free energy: an analytical approach and its application to cooperative Ca2+ by calbindin D9k. J. Am. Chem. Soc. 115, 9832–9833. 10.1021/ja00074a073
3
AnafiM.RosenM. K.GishG. D.KayL. E.PawsonT. (1996). A potential SH3 domain-binding site in the Crk SH2 domain. J. Biol. Chem. 271, 21365–21374. 10.1074/jbc.271.35.21365
4
BartelsC.XiaT.GuntertP.BilleterM.WuthrichK. (1995). The program XEASY for computer-supported NMR spectral analysis. J. Biomol. NMR5, 1–10. 10.1007/BF00417486
5
BraunD.WiderG.WuethrichK. (1994). Sequence-corrected 15N “Random Coil” chemical shifts. J. Am. Chem. Soc. 116, 8466–8469. 10.1021/ja00098a005
6
CamareroJ. A.CottonG. J.AdevaA.MuirT. W. (1998a). Chemical ligation of unprotected peptides directly from a solid support. J. Pept. Res. 51, 303–316. 10.1111/j.1399-3011.1998.tb00428.x
7
CamareroJ. A.FushmanD.CowburnD.MuirT. W. (2001a). Peptide chemical ligation inside living cells: in vivo generation circular protein domain. Bioorg. Med. Chem. 9, 2479–2484. 10.1016/S0968-0896(01)00217-6
8
CamareroJ. A.FushmanD.SatoS.GiriatI.CowburnD.RaleighD. P.et al. (2001b). Rescuing a destabilized protein fold through backbone cyclization. J. Mol. Biol. 308, 1045–1062. 10.1006/jmbi.2001.4631
9
CamareroJ. A.MuirT. W. (1999). Biosynthesis of a head-to-tail cyclized protein with improved biological activity. J. Am. Chem. Soc. 121, 5597–5598. 10.1021/ja990929n
10
CamareroJ. A.PavelJ.MuirT. W. (1998b). Chemical synthesis of a circular protein domain; evidence for folding-assisted cyclization. Angew. Chem. Int. Ed. 37, 347–349.
11
DeechongkitS.KellyJ. W. (2002). The effect of backbone cyclization on the thermodynamics of beta-sheet unfolding: stability optimization of the PIN WW domain. J. Am. Chem. Soc. 124, 4980–4986. 10.1021/ja0123608
12
EvansT. C.BennerJ.XuM.-Q. (1999). The cyclization and polymerization of bacterially expressed proteins using modified sef-splicing inteins. J. Biol. Chem. 274, 18359–18381. 10.1074/jbc.274.26.18359
13
EvansT. C.Jr.MartinD.KollyR.PanneD.SunL.GhoshI.et al. (2000). Protein trans-splicing and cyclization by a naturally split intein from the dnaE gene of Synechocystis species PCC6803. J. Biol. Chem. 275, 9091–9094. 10.1074/jbc.275.13.9091
14
FushmanD. (2012). Determining protein dynamics from (15)N relaxation data by using DYNAMICS. Methods Mol. Biol. 831, 485–511. 10.1007/978-1-61779-480-3_24
15
FushmanD.CahillS.CowburnD. (1997). The main chain dynamics of the dynamin pleckstrin homology (PH) domain in solution: analysis of 15N relaxation with monomer/dimer equilibration. J. Mol. Biol. 266, 173–194. 10.1006/jmbi.1996.0771
16
FushmanD.CowburnD. (1998). Model-independent analysis of 15N chemical shift anisotropy from NMR relaxation data. Ubiquitin as a test example. J. Am. Chem. Soc. 120, 7109–7110. 10.1021/ja980565j
17
FushmanD.CowburnD. (2001). Nuclear magnetic resonance relaxation in determination of residue-specific 15N chemical shift tensors in proteins in solution: protein dynamics, structure, and applications of transverse relaxation optimized spectroscopy. Meth. Enzymol. 339, 109–126. 10.1016/S0076-6879(01)39312-6
18
FushmanD.TjandraN.CowburnD. (1999a). An approach to direct determination of protein dynamics from 15N NMR relaxation at multiple fields, independent of variable 15N chemical shift anisotropy and chemical exchange contributions. J. Am. Chem. Soc. 121, 8577–8582. 10.1021/ja9904991
19
FushmanD.WeisemannR.ThüringH.RüterjansH. (1994). Backbone dynamics of ribonuclease T1 and its complex with 2'GMP studied by two-dimensional heteronuclear NMR spectroscopy. J. Biomol. NMR4, 61–78. 10.1007/BF00178336
20
FushmanD.XuR.CowburnD. (1999b). Direct determination of changes of interdomain orientation on ligation: use of the orientational dependence of 15N NMR relaxation in Abl SH(32). Biochemistry38, 10225–10230. 10.1021/bi990897g
21
GoldenbergD. P.CreightonT. E. (1984). Folding pathway of a circular form of bovine pancreatic trypsin inhibitor. J. Mol. Biol. 179, 527–545. 10.1016/0022-2836(84)90078-0
22
GrantcharovaV. P.RiddleD. S.BakerD. (2000). Long-range order in the src SH3 folding transition state. Proc. Natl. Acad. Sci. U.S.A. 97, 7084–7089. 10.1073/pnas.97.13.7084
23
GrzesiekS.BaxA. (1993). The importance of not saturating H2O in protein NMR—application to sensitivity enhancement and NOE measurements. J. Am. Chem. Soc. 115, 12593–12594. 10.1021/ja00079a052
24
GuentertP.MumenthalerC.WuthrichK. (1997). Torsion angle dynamics for NMR structure calculation with the new program DYANA. J. Mol. Biol. 273, 283–298. 10.1006/jmbi.1997.1284
25
HallJ. B.DayieK. T.FushmanD. (2003). Direct measurement of the 15N CSA/dipolar relaxation interference from coupled HSQC spectra. J. Biomol. NMR26, 181–186. 10.1023/A:1023546107553
26
HallJ. B.FushmanD. (2003). Characterization of the overall and local dynamics of a protein with intermediate rotational anisotropy: differentiating between conformational exchange and anisotropic diffusion in the B3 domain of protein G. J. Biomol. NMR27, 261–275. 10.1023/A:1025467918856
27
HallJ. B.FushmanD. (2006). Variability of the 15N chemical shielding tensors in the B3 domain of protein G from 15N relaxation measurements at several fields. Implications for backbone order parameters. J. Am. Chem. Soc. 128, 7855–7870. 10.1021/ja060406x
28
HrubyV. J. (1982). Conformational restrictions of biologically active peptides via amino acid side chain groups. Life Sci. 31, 189–199. 10.1016/0024-3205(82)90578-1
29
HrubyV. J.Al-ObeidiF.KazmierskiW. (1990). Emerging approaches in the molecular design of receptor-selective peptide ligands: conformational, topographical and dynamic considerations. Biochem. J. 268, 249–262.
30
IwaiH.PluckthunA. (1999). Circular beta-lactamase: stability enhancement by cyclizing the backbone. FEBS Lett. 459, 166–172. 10.1016/S0014-5793(99)01220-X
31
IwakuraM.NakamuraT. (1998). Effects of the length of a glycine linker connecting the N-and C- termini of a circularly permuted dihydrofolate reductase. Protein Eng. 11, 707–713. 10.1093/protein/11.8.707
32
JagadishK.BorraR.LaceyV.MajumderS.ShekhtmanA.WangL.et al. (2013). Expression of fluorescent cyclotides using protein trans-splicing for easy monitoring of cyclotide-protein interactions. Angew. Chem. Int. Ed. Engl. 52, 3126–3131. 10.1002/anie.201209219
33
KesslerH. (1982). Conformational and biological activity of cyclic peptides. Angew. Chem. Int. Ed. Engl. 21, 512–523. 10.1002/anie.198205121
34
KimuraR. H.TranA. T.CamareroJ. A. (2006). Biosynthesis of the cyclotide kalata B1 by using protein splicing. Angew. Chem. Int. Ed. 45, 973–976. 10.1002/anie.200503882
35
KlimovD. K.ThirumalaiD. (2002). Stiffness of the distal loop restricts the structural heterogeneity of the transition state ensemble in SH3 domains. J. Mol. Biol. 317, 721–737. 10.1006/jmbi.2002.5453
36
KnudsenB. S.FellerS. M.HanafusaH. (1994). Four proline-rich sequences of the guanine-nucleotide exchange factor C3g bind with unique specificity to the first Src homology 3 domain of Crk. J. Biol. Chem. 269, 32781–32787.
37
KnudsenB. S.ZhengJ.FellerS. M.MayerJ. P.BurrellS. K.CowburnD.et al. (1995). Affinity and specificity requirements for the first Src homology 3 domain of the Crk proteins. EMBO J. 14, 2191–2198.
38
KoradiR.BilleterM.WuthrichK. (1996). MOLMOL: a program for display and analysis of macromolecular structures. J. Mol. Graph. 14, 51–55. 10.1016/0263-7855(96)00009-4
39
LeeT. D.VemuriS. (1990). MacProMass: a computer program to correlate mass spectral data to peptide and protein structures. Biomed. Environ. Mass Spectrom. 19, 639–645. 10.1002/bms.1200191103
40
LiZ.RaychaudhuriS.WandA. J. (1996). Insights into the local residual entropy of proteins provided by NMR relaxation. Protein Sci. 5, 2647–2650. 10.1002/pro.5560051228
41
LipariG.SzaboA. (1982). Model-free approach to the interpretation of nuclear magnetic resonance relaxation in macromolecules. 1. Theory and range of validity. J. Am. Chem. Soc. 104, 4546–4559. 10.1021/ja00381a009
42
LoriaJ. P.RanceM.PalmerA. G. I. (1999). A relaxation-compensated carr-purcell-meiboom-gill sequence for characterizing chemical exchange by NMR spectroscopy. J. Am. Chem. Soc. 121, 2331–2332. 10.1021/ja983961a
43
MartinezJ. C.VigueraA. R.BerisioR.WilmannsM.MateoP. L.FilimonovV. V.et al. (1999). Thermodynamic analysis of alpha-spectrin SH3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins. Biochemistry38, 549–559. 10.1021/bi981515u
44
MatsumuraM.MatthewsB. W. (1991). Stabilization of functional proteins by introduction of multiple disulfide bonds. Methods Enzymol. 202, 336–356. 10.1016/0076-6879(91)02018-5
45
MumenthalerC.GuntertP.BraunW.WuthrichK. (1997). Automated combined assignment of NOESY spectra and three-dimensional protein structure determination. J. Biomol. NMR10, 351–362. 10.1023/A:1018383106236
46
OtzenD. E.FershtA. R. (1998). Folding of circular and permuted chymotrypsin inhibitor 2: retention of the folding nucleus. Biochemistry37, 8139–8146. 10.1021/bi980250g
47
ScottC. P.Abel-SantosE.WallM.WahnonD.BenkovicS. J. (1999). Production of cyclic peptides and proteins in vivo. Proc. Natl. Acad. Sci. U.S.A. 96, 13638–13643. 10.1073/pnas.96.24.13638
48
StoneM. J. (2001). NMR relaxation studies of the role of conformational entropy in protein stability and ligand binding. Acc. Chem. Res. 34, 379–388. 10.1021/ar000079c
49
TamJ. P.LuY. A. (1998). A biomimetic strategy in the synthesis and fragmentation of cyclic protein. Protein Sci. 7, 1583–1592. 10.1002/pro.5560070712
50
ThorntonJ. M.SibandaB. L. (1983). Amino and carboxy-terminal regions in globular proteins. J. Mol. Biol. 167, 443–460. 10.1016/S0022-2836(83)80344-1
51
TjandraN.SzaboA.BaxA. (1996). Protein backbone dynamics and 15N chemical shift anisotropy from quantitative measurement of relaxation interference effects. J. Am. Chem. Soc. 118, 6986–6991. 10.1021/ja960510m
52
TrabiM.CraikD. J. (2002). Circular proteins—no end in sight. Trends Biochem. Sci. 27, 132–138. 10.1016/S0968-0004(02)02057-1
53
WalkerO.VaradanR.FushmanD. (2004). Efficient and accurate determination of the overall rotational diffusion tensor of a molecule from 15N relaxation data using computer program ROTDIF. J. Magn. Reson. 168, 336–345. 10.1016/j.jmr.2004.03.019
54
WangL.PangY.HolderT.BrenderJ. R.KurochkinA. V.ZuiderwegE. R. (2001). Functional dynamics in the active site of the ribonuclease binase. Proc. Natl. Acad. Sci. U.S.A. 98, 7684–7689. 10.1073/pnas.121069998
55
WuX.KnudsenB.FellerS. M.ZhengJ.SaliA.CowburnD.et al. (1995). Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk. Structure3, 215–226. 10.1016/S0969-2126(01)00151-4
56
WuthrichK. (1986). NMR of Proteins and Nucleic Acids. New York, NY: Wiley.
57
YangD.KayL. E. (1996). Contributions to conformational entropy arising from bond vector fluctuations measured from NMR-derived order parameters: application to protein folding. J. Mol. Biol. 263, 369–382. 10.1006/jmbi.1996.0581
58
YoungT. S.YoungD. D.AhmadI.LouisJ. M.BenkovicS. J.SchultzP. G. (2011). Evolution of cyclic peptide protease inhibitors. Proc. Natl. Acad. Sci. U.S.A. 108, 11052–11056. 10.1073/pnas.1108045108
Summary
Keywords
circular SH3, c-Crk, backbone dynamics, protein cyclization, inteins
Citation
Schumann FH, Varadan R, Tayakuniyil PP, Grossman JH, Camarero JA and Fushman D (2015) Changing the topology of protein backbone: the effect of backbone cyclization on the structure and dynamics of a SH3 domain. Front. Chem. 3:26. doi: 10.3389/fchem.2015.00026
Received
10 February 2015
Accepted
23 March 2015
Published
08 April 2015
Volume
3 - 2015
Edited by
Xuechen LI, The University of Hong Kong, China
Reviewed by
Evripidis Gavathiotis, Albert Einstein College of Medicine, USA; Stefan G. D. Rüdiger, Utrecht University, Netherlands
Copyright
© 2015 Schumann, Varadan, Tayakuniyil, Grossman, Camarero and Fushman.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Julio A. Camarero, Department of Pharmacology and Pharmaceutical Sciences, School of Pharmacy, University of Southern California, 1985 Zonal Avenue, Los Angeles, CA 90033, USA jcamarer@usc.edu;
†Present Address: Frank H. Schumann, Bruker Biospin AG, Fällanden, Switzerland;
This article was submitted to Chemical Biology, a section of the journal Frontiers in Chemistry
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.