ORIGINAL RESEARCH article

Front. Plant Sci., 22 March 2016

Sec. Plant Physiology

Volume 7 - 2016 | https://doi.org/10.3389/fpls.2016.00301

Identification and Comparative Analysis of H2O2-Scavenging Enzymes (Ascorbate Peroxidase and Glutathione Peroxidase) in Selected Plants Employing Bioinformatics Approaches

  • 1. Department of Biology, Faculty of Science and Arts, Marmara University Istanbul, Turkey

  • 2. Department of Crop and Animal Production, Cilimli Vocational School, Düzce University Düzce, Turkey

  • 3. Department of Molecular Biology and Genetics, Faculty of Science, Istanbul Medeniyet University Istanbul, Turkey

  • 4. Department of Molecular Biology and Genetics, Faculty of Science, Gebze Technical University Kocaeli, Turkey

  • 5. Botany Department/Center for Environmental Studies, Ege University Izmir, Turkey

  • 6. Faculty of Forestry, Universiti Putra Malaysia Selangor, Malaysia

  • 7. Centre for Environmental and Marine Studies and Department of Chemistry, University of Aveiro Aveiro, Portugal

Abstract

Among major reactive oxygen species (ROS), hydrogen peroxide (H2O2) exhibits dual roles in plant metabolism. Low levels of H2O2 modulate many biological/physiological processes in plants; whereas, its high level can cause damage to cell structures, having severe consequences. Thus, steady-state level of cellular H2O2 must be tightly regulated. Glutathione peroxidases (GPX) and ascorbate peroxidase (APX) are two major ROS-scavenging enzymes which catalyze the reduction of H2O2 in order to prevent potential H2O2-derived cellular damage. Employing bioinformatics approaches, this study presents a comparative evaluation of both GPX and APX in 18 different plant species, and provides valuable insights into the nature and complex regulation of these enzymes. Herein, (a) potential GPX and APX genes/proteins from 18 different plant species were identified, (b) their exon/intron organization were analyzed, (c) detailed information about their physicochemical properties were provided, (d) conserved motif signatures of GPX and APX were identified, (e) their phylogenetic trees and 3D models were constructed, (f) protein-protein interaction networks were generated, and finally (g) GPX and APX gene expression profiles were analyzed. Study outcomes enlightened GPX and APX as major H2O2-scavenging enzymes at their structural and functional levels, which could be used in future studies in the current direction.

Introduction

Reactive oxygen species (ROS), once perceived as toxic by-products, were known to cause oxidative damage in cells (Mittler et al., 2004; Suzuki and Mittler, 2006). Later, novel regulatory roles of these species were revealed in a wide range of biological processes such as cell signaling, growth, development, programmed cell death, and plant responses to various biotic/abiotic stress factors (Mullineaux and Karpinski, 2002; Uzilday et al., 2014). H2O2 is an endogenous ROS species known to play a dual role in plants, where it is beneficial at low concentrations but lethal at higher levels (Petrov and Van Breusegem, 2012). Nevertheless, at steady state levels, H2O2 acts as signaling molecule inducing the signal transduction mechanism to produce various cellular responses. Interestingly, pre-treatment of plants with H2O2 makes them more tolerant to biotic/abiotic stresses (Hossain et al., 2015). H2O2 was also noted for its regulatory functions in photosynthesis, cell cycle, development, senescence, and apoptosis (Mittler et al., 2004; Petrov and Van Breusegem, 2012). H2O2 has been accepted as a central component of signal transduction pathways in plant-adaptation to altered environmental conditions as it is both the only ROS with high permeability across membranes (that enables the transport of signals to distant sites) and its high stability when compared to other ROS with ~1 ms half-life (Bienert et al., 2007; Dynowski et al., 2008; Petrov and Van Breusegem, 2012). On the other hand, when the delicate balance between production and scavenging of H2O2 is disturbed, its overproduction results in significant damage to cell structures (Anjum et al., 2015; Sofo et al., 2015). To overcome H2O2-related cellular damage, aerobic organisms have developed various antioxidant machineries with enzymatic and non-enzymatic components. Ascorbate peroxidase (APX), glutathione peroxidase (GPX), and catalase (CAT) are the main enzymes responsible for suppressing toxic levels of H2O2 (Apel and Hirt, 2004). However, APX may have pivotal roles in ROS-scavenging because even very low concentrations are sufficient for H2O2 decomposition (Anjum et al., 2014; Sofo et al., 2015).

APX (EC, 1.11.1.11) belongs to the plant-type heme peroxidase superfamily in plants (Lazzarotto et al., 2011). Genome-wide studies demonstrated that APX in higher plants is encoded by multigenic families. Arabidopsis was reported to contain nine APX genes; whereas, rice has eight and tomato seven (Chew et al., 2003; Teixeira et al., 2004; Najami et al., 2008). Different isoforms are classified into sub-families according to their subcellular localization. Transmembrane domains in N- and C- terminal regions, as well as organelle-specific target molecules are the primary determinants in target localization of APXs (Ishikawa et al., 1998; Negi, 2011). Among nine APX genes identified in Arabidopsis, three were found to be encoded in cytosol whereas the other six were distributed in stroma, thylakoid, and peroxisome (Chew et al., 2003; Mittler et al., 2004). In rice, chloroplastic isoforms were expressed by three genes, cytosolic and peroxisomal forms were both encoded by two genes, and one gene was for the mitochondrial APX (Teixeira et al., 2006; Anjum et al., 2014). APX activity was also reported to increase under various stress conditions. For example, APX is differentially upregulated in response to heavy metal, drought, water, and heat stress (Sharma and Dubey, 2005; Koussevitzky et al., 2008; Yang et al., 2008; Anjum et al., 2014). In a previous study, Arg-38, Glu-65, Asn-71, and Asp208 residues were reported to be conserved among the entire APX family and known to be important in ligand (heme)-binding (Welinder, 1992). In addition to enzymatic properties, structural investigations on catalytic domains of the enzymes have been also performed. Three-dimensional structures of cAPX, sAPX, and their substrates showed the relationship between loop structure and stability in the absence of ascorbate (AsA; Yabuta et al., 2000; Anjum et al., 2014). The mitochondrial and chloroplastic APXs (< 30 s) have shorter half inactivation times (>1 h) compared to cytosolic and peroxisomal isoforms, which makes them more sensitive in either low concentrations or the absence of AsA (Caverzan et al., 2012; Anjum et al., 2014). Another important enzyme in H2O2-scavenging is the GPX from the non-heme containing peroxidase family (Bela et al., 2015). In Arabidopsis, eight GPX genes were reported (Milla et al., 2003; Koua et al., 2009). Based on in silico analysis, GPXs were predicted in chloroplast, mitochondria, cytosol, and ER localizations (Rouhier and Jacquot, 2005), and demonstrated high level of sequence similarity with strictly conserved cysteines and motifs (Dietz, 2011). Plant GPXs have cysteine residue in their active site (Koua et al., 2009), which is functional in both glutathione (GSH) and thiol peroxidase classes of the non-heme family. GPXs were also reported to be involved in stress responses. Many studies have demonstrated the significant increase in mRNA levels of GPXs under various abiotic/abiotic stress conditions such as oxidative stress, pathogen attack, metal, cold, drought, and salt (Navrot et al., 2006; Diao et al., 2014; Fu, 2014; Gao et al., 2014). For example, GPX genes were found to be upregulated under excess H2O2 and cold stresses in rice (Passaia et al., 2013). Transcriptome analysis indicated high level of GPX transcripts in dehydrated Glycine max samples (Criqui et al., 1992; Ferreira Neto et al., 2013). Several transgenic studies also supported the proposed function of GPXs. For example, the overexpression of GPX in its transgenic tomato resulted in higher tolerance against abiotic stress (Herbette et al., 2011). In addition to stress response, GPXs are also thought to regulate cellular redox homeostasis by modulating the thiol-disulfide balance (Bela et al., 2015). GPX expression was found to be highly upregulated to maintain redox homeostasis under oxidative stress which helped Brassica rapa to adapt long-term spaceflight (Sugimoto et al., 2014).

A scan of contemporary literature reveals a paucity of information on the identification and comparative analysis of GPX and APX in model and economically important food crops. Given the above, employing bioinformatics approaches, efforts were made in this study (a) to identify potential GPX and APX genes/proteins from 18 different plant species, (b) to analyze their exon/intron organization, (c) to provide detailed information about their physico-chemical properties, (d) to identify conserved motif signatures of GPX and APX, (e) to construct their phylogenetic trees and 3D models, (f) to generate protein-protein interaction networks, and finally (g) to analyze GPX and APX gene expression profiles.

Materials and methods

Retrieval of GPX and APX genes/proteins

Eight Arabidopsis GPX reference protein sequences such as GPX1 (P52032.2), GPX2 (O04922.1), GPX3 (O22850.1), GPX4 (Q8L910.1), GPX5 (Q9LYB4.1), GPX6 (O48646.2), GPX7 (Q9SZ54.2), and GPX8 (Q8LBU2.1), as well as and eight Arabidopsis APX reference sequences such as APX1 (Q05431.2), APX2 (Q1PER6.3), APX3 (Q42564.1), APX4 (P82281.2), APX5 (Q7XZP5.2), APX6 (Q8GY91.1), APXT (Q42593.2), and APXS (Q42592.2) were obtained from UniProtKB/Swiss-Prot database of NCBI (Romiti, 2006). These reference sequences were queried in proteome datasets of selected 18 plant species: Arabidopsis thaliana (L.) Heynh., Brachypodium distachyon (L.) P. Beauv., Brasica rapa L., Chlamydomonas reinhardtii P. A. Dang., Cucumis sativus L., Eucalyptus grandis W. Hill ex Maiden, Glycine max (L.) Merr., Gossypium raimondii Ulbr., Medicago truncatula Gaertn., Oryza sativa L., Phaseolus vulgaris L., Physcomitrella patens (Hedw.) Bruch & Schimp., Populus trichocarpa Torr. & A.Gray ex. Hook., Prunus persica (L.) Batsch, Solanum lycopersicum L., Sorghum bicolor (L.) Moench, Vitis vinifera L., and Zea mays L., all found in the Phytozome v.10.3 database (Goodstein et al., 2012). After sequences were obtained, the Hidden Markov Model (HMM) search of protein sequences were performed by Pfam (http://pfam.sanger.ac.uk) to confirm the protein domain families (Finn et al., 2016). Species were arbitrarily selected to represent the main plant groups such as monocots, dicots, and lower plants.

Analysis of GPX and APX genes/proteins

Physicochemical properties of GPX and APX proteins were determined by using ProtParam tool (Gasteiger et al., 2005). Sub-cellular localization was predicted by CELLO (Yu et al., 2006) and WoLF PSORT (Horton et al., 2007) servers. Exon-intron organization of GPX/APX genes was analyzed by using a GSDS server (Hu et al., 2014). The Conserved motif structure of GPX/APX sequences was analyzed using the MEME tool with the following parameter settings: maximum number of motifs to find, 5; minimum width of motif, 6 and maximum width of motif, 50 (Bailey et al., 2009). Protein sequences were aligned by ClustalW (Thompson et al., 1994) and phylogenies were constructed by MEGA 6 (Tamura et al., 2013) with the maximum likelihood (ML) method for 1.000 bootstraps. The gene duplication events were detected using the following criteria: (a) length of alignable sequence covers >75% of the longer gene, and (b) similarity of aligned regions is >75% (Gu et al., 2002). The expression data of APX and GPX genes at anatomical and developmental levels were retrieved from the Genevestigator database (Hruz et al., 2008). 3D models of APX/GPXs were predicted by using the Phyre2 server (Kelley and Sternberg, 2009). Model validation was performed by Rampage Ramachandran plot analysis (Lovell et al., 2003). 3D structure comparisons were done by calculating RMSD values of models using the CLICK server employing α-carbon superposition (Nguyen et al., 2011). Putative interaction partners of APX/GPXs were predicted with the STRING server (Franceschini et al., 2013) and an interactome network was generated using cytoscape (Smoot et al., 2011).

Results and discussion

H2O2 plays double roles in plants and modulates various crucial metabolic processes (Petrov and Van Breusegem, 2012). However, its increased levels can cause severe damage to cell structures; hence, steady-state level of cellular H2O2 is required to be tightly regulated (Anjum et al., 2014, 2015; Sofo et al., 2015). GPX and APX are two major ROS-scavenging enzymes which catalyze the reduction of H2O2 to prevent H2O2-derived cellular damage. In order to understand the structural, functional as well as evolutionary aspects of GPX and APX, employing bioinformatics approaches, this study attempted to present comparative analyses of putative GPX and APX homologs identified from18 plant species.

Analysis of GPXs

Retrieval of GPX genes/proteins

Eight potential Arabidopsis GPX protein sequences, namely GPX1-8, obtained from the UniProtKB/Swiss-Prot database of NCBI were used as queries in Phytozome database to retrieve the very close homologs of GPX sequences in 18 plant species. In the selection of GPX homologs from blastp hits, very strict criteria (only the highest hit sequence) was applied to avoid the redundant sequences and alternative splices of the same gene. A total of 87 GPX sequences were identified from the protein datasets of 18 plant species. These include; 8 genes for A. thaliana, 4 genes for B. distachyon, 8 genes for B. rapa, 1 gene for C. reinhardtii, 6 genes for C. sativus, 5 genes for E. grandis, 5 genes for G. max, 6 genes for G. raimondii, 5 genes for M. truncatula, 5 genes for O. sativa, 5 genes for P. vulgaris, 2 genes for P. patens, 5 genes for P. trichocarpa, 5 genes for P. persica, 5 genes for S. lycopersicum, 4 genes for S. bicolor, 5 genes for V. vinifera, and 3 genes for Z. mays (Table 1). Then, genomic, transcript, CDS, and protein sequences of identified 87 GPX sequences were retrieved for further analyses.

Table 1

Species namePhytozome gene IDGene/protein features of GPX sequences
Protein domain familyaDomain family descriptionExon no.Protein lengthMW (KDa)Theor. pILocalization CELLObLocalization WoLF PSORTb
Arabidopsis thaliana (L.) Heynh.AT1G63460GSHPx (PF00255)Glutathione peroxidase616719.05.11CytoCyto
AT2G25080GSHPx (PF00255)Glutathione peroxidase623626.09.42Chlo/MitoChlo
AT2G31570GSHPx (PF00255)Glutathione peroxidase616918.95.60CytoCyto
AT2G43350GSHPx (PF00255)Glutathione peroxidase620623.29.24Mito/PlasChlo/Mito
AT2G48150GSHPx (PF00255)Glutathione peroxidase617019.38.87CytoMito
AT3G63080GSHPx (PF00255)Glutathione peroxidase617319.39.28Extr/Chlo/NuclChlo
AT4G11600GSHPx (PF00255)Glutathione peroxidase623225.59.38Mito/ChloMito
AT4G31870GSHPx (PF00255)Glutathione peroxidase623325.79.53ChloChlo
Brachypodium distachyon (L.) P.Beauv.Bradi1g47140GSHPx (PF00255)Glutathione peroxidase622624.49.57ChloChlo
Bradi1g61930GSHPx (PF00255)Glutathione peroxidase619822.47.56CytoCyto
Bradi3g51010GSHPx (PF00255)Glutathione peroxidase624025.99.05ChloChlo
Bradi5g18000GSHPx (PF00255)Glutathione peroxidase616818.46.31Cyto/ChloNucl/Chlo
Brasica rapa L.Brara.B02692GSHPx (PF00255)Glutathione peroxidase622925.29.21MitoChlo/Mito
Brara.C02198GSHPx (PF00255)Glutathione peroxidase619721.98.55Extr/PlasExtr
Brara.E00003GSHPx (PF00255)Glutathione peroxidase617019.29.05Extr/CytoChlo
Brara.E01208GSHPx (PF00255)Glutathione peroxidase616918.96.34CytoCyto
Brara.G01994GSHPx (PF00255)Glutathione peroxidase617619.59.15Extr/Cyto/NuclChlo
Brara.I01234GSHPx (PF00255)Glutathione peroxidase616718.95.00CytoCyto
Brara.I04448GSHPx (PF00255)Glutathione peroxidase623325.89.29Mito/Chlo/ExtrChlo
Brara.K00392GSHPx (PF00255)Glutathione peroxidase623225.99.60Mito/ExtrChlo
Chlamydomonas reinhardtii P.A.Dang.Cre03.g197750GSHPx (PF00255)Glutathione peroxidase720021.99.39MitoChlo
Cucumis sativus L.Cucsa.084960GSHPx (PF00255)Glutathione peroxidase617619.78.86CytoChlo
Cucsa.094950GSHPx (PF00255)Glutathione peroxidase620423.48.55Plas/ExtrChlo
Cucsa.184280GSHPx (PF00255)Glutathione peroxidase617019.08.66Cyto/ExtrCyto
Cucsa.271420GSHPx (PF00255)Glutathione peroxidase624126.49.5ChloChlo
Cucsa.303050GSHPx (PF00255)Glutathione peroxidase624126.89.28MitoChlo/Mito
Cucsa.303070GSHPx (PF00255)Glutathione peroxidase617019.25.21CytoCyto
Eucalyptus grandis W. Hill ex MaidenEucgr.A00257GSHPx (PF00255)Glutathione peroxidase620222.87.62Extr/ChloChlo/Vacu
Eucgr.C02602GSHPx (PF00255)Glutathione peroxidase624726.99.53ChloChlo
Eucgr.D01856GSHPx (PF00255)Glutathione peroxidase617019.45.16CytoCyto
Eucgr.E00579GSHPx (PF00255)Glutathione peroxidase625027.39.16ChloChlo
Eucgr.K03389GSHPx (PF00255)Glutathione peroxidase617018.99.02CytoChlo/Nucl
Glycine max (L.) Merr.Glyma.03G151500GSHPx (PF00255)Glutathione peroxidase617019.09.45Mito/CytoChlo
Glyma.05G240100GSHPx (PF00255)Glutathione peroxidase619922.77.54ExtrExtr
Glyma.08G013900GSHPx (PF00255)Glutathione peroxidase616718.95.09CytoChlo
Glyma.11G024100GSHPx (PF00255)Glutathione peroxidase616718.55.88CytoCyto
Glyma.17G223900GSHPx (PF00255)Glutathione peroxidase623426.39.40Mito/ChloChlo
Gossypium raimondii Ulbr.Gorai.001G038600GSHPx (PF00255)Glutathione peroxidase624226.69.30ChloChlo
Gorai.004G083200GSHPx (PF00255)Glutathione peroxidase617119.19.24Nucl/Cyto/ExtrNucl
Gorai.004G087300GSHPx (PF00255)Glutathione peroxidase620823.65.51ExtrExtr
Gorai.004G211400GSHPx (PF00255)Glutathione peroxidase616618.46.73CytoChlo
Gorai.006G186100GSHPx (PF00255)Glutathione peroxidase616818.76.73CytoCyto
Gorai.008G246600GSHPx (PF00255)Glutathione peroxidase616819.14.59CytoChlo
Zea mays L.GRMZM2G012479GSHPx (PF00255)Glutathione peroxidase623024.99.55MitoChlo
GRMZM2G144153GSHPx (PF00255)Glutathione peroxidase616818.46.58CytoChlo/Nucl
GRMZM2G329144GSHPx (PF00255)Glutathione peroxidase617019.27.58CytoChlo
Vitis vinifera L.GSVIVG01010737001GSHPx (PF00255)Glutathione peroxidase616718.65.53CytoCyto
GSVIVG01011101001GSHPx (PF00255)Glutathione peroxidase617019.09.22CytoMito
GSVIVG01019765001GSHPx (PF00255)Glutathione peroxidase617019.25.01CytoCyto
GSVIVG01019766001GSHPx (PF00255)Glutathione peroxidase616818.66.73CytoChlo/Extr
GSVIVG01035981001GSHPx (PF00255)Glutathione peroxidase620722.99.16Chlo/MitoChlo
Oryza sativa L.LOC_Os02g44500GSHPx (PF00255)Glutathione peroxidase623825.89.42ChloChlo
LOC_Os03g24380GSHPx (PF00255)Glutathione peroxidase616919.28.80CytoCyto
LOC_Os04g46960GSHPx (PF00255)Glutathione peroxidase616818.48.33CytoChlo
LOC_Os06g08670GSHPx (PF00255)Glutathione peroxidase6234259.51Mito/ChloChlo
LOC_Os11g18170GSHPx (PF00255)Glutathione peroxidase621222.97.62Chlo/ExtrChlo
Medicago truncatula Gaertn.Medtr1g014210GSHPx (PF00255)Glutathione peroxidase623626.49.32Mito/ChloChlo
Medtr7g094600GSHPx (PF00255)Glutathione peroxidase617019.29.18Cyto/MitoNucl
Medtr8g098400GSHPx (PF00255)Glutathione peroxidase617219.34.82CytoChlo
Medtr8g098410GSHPx (PF00255)Glutathione peroxidase623325.89.27MitoChlo
Medtr8g105630GSHPx (PF00255)Glutathione peroxidase616718.98.32PlasChlo
Physcomitrella patens (Hedw.) Bruch & Schimp.Phpat.004G103100GSHPx (PF00255)Glutathione peroxidase624726.79.24Chlo/ExtrChlo
Phpat.017G045400GSHPx (PF00255)Glutathione peroxidase117019.18.30CytoCyto
Phaseolus vulgaris L.Phvul.001G041100GSHPx (PF00255)Glutathione peroxidase626229.79.68MitoChlo
Phvul.001G149000GSHPx (PF00255)Glutathione peroxidase616818.89.31Cyto/NuclNucl
Phvul.002G157200GSHPx (PF00255)Glutathione peroxidase617019.04.97CytoChlo/Nucl
Phvul.002G288700GSHPx (PF00255)Glutathione peroxidase623025.68.76Chlo/MitoChlo
Phvul.002G322400GSHPx (PF00255)Glutathione peroxidase619822.55.94ExtrExtr
Populus trichocarpa Torr. & A.Gray ex. Hook.Potri.001G105100GSHPx (PF00255)Glutathione peroxidase517019.34.78CytoCyto
Potri.003G126100GSHPx (PF00255)Glutathione peroxidase623826.29.29Mito/ChloChlo
Potri.006G265400GSHPx (PF00255)Glutathione peroxidase623225.39.48Chlo/MitoChlo
Potri.007G126600GSHPx (PF00255)Glutathione peroxidase620322.86.83ExtrExtr/Vacu
Potri.014G138800GSHPx (PF00255)Glutathione peroxidase617018.99.15Cyto/ExtrChlo/Cyto
Prunus persica (L.) Batschppa010584m.gGSHPx (PF00255)Glutathione peroxidase624426.79.33ChloChlo
ppa010771m.gGSHPx (PF00255)Glutathione peroxidase623725.99.20MitoChlo
ppa011682m.gGSHPx (PF00255)Glutathione peroxidase620022.78.27Extr/CytoExtr
ppa012378m.gGSHPx (PF00255)Glutathione peroxidase617219.48.97CytoNucl/Cyto
ppa012416m.gGSHPx (PF00255)Glutathione peroxidase617019.44.86CytoChlo
Sorghum bicolor (L.) MoenchSobic.001G365800GSHPx (PF00255)Glutathione peroxidase617119.38.79CytoChlo
Sobic.006G173900GSHPx (PF00255)Glutathione peroxidase616818.46.58CytoChlo/Nucl
Sobic.010G067100GSHPx (PF00255)Glutathione peroxidase623224.99.50Mito/ChloChlo
Sobic.K022000GSHPx (PF00255)Glutathione peroxidase620522.65.68Cyto/ExtrMito/Chlo
Solanum lycopersicum L.Solyc06g073460.2GSHPx (PF00255)Glutathione peroxidase616718.96.37CytoChlo
Solyc08g006720.2GSHPx (PF00255)Glutathione peroxidase623826.29.18ChloChlo
Solyc08g080940.2GSHPx (PF00255)Glutathione peroxidase623926.79.16MitoChlo
Solyc09g064850.2GSHPx (PF00255)Glutathione peroxidase617019.09.33Mito/ExtrChlo
Solyc12g056240.1GSHPx (PF00255)Glutathione peroxidase617019.34.97CytoCyto

List of H2O2-scavenging enzyme glutathione peroxidase (GPX) homologs from 18 plant species and their primary gene/protein features.

a

Protein domain families were searched in Pfam database.

b

Cyto, Cytosolic; Chlo, Chloroplastic; Mito, Mitochondrial; Vacu, Vacuolar; Nucl, Nuclear; Extr, Extracellular; Plas, Plasma membrane.

More than one localization specified in a single column also shows the significance of other entries in order.

Sequence analysis of GPX genes/proteins

A total of 87 GPX homologs were identified in the protein datasets of 18 plant species using Arabidopsis GPX1-8 for homology search. Identified GPX homologs belonged to the GSHPx (PF00255) protein family. They encoded a polypeptide of 166–262 amino acids residues (average length 197.5) and 18.4–29.7 kDa molecular weight with 4.59–9.60 pI value. The sequence variations in analyzed GPXs primarily derived from the “transit peptide” residues between organelle and non-organelle related GPXs (Table 1). Studies of molecular cloning and sequencing in A. thaliana have reported that chloroplastic GPX1 and GPX7 consisted of 236 and 233 amino acids, respectively; the first 1–64 residues in GPX1 and 1–69 residues in GPX7 from N-terminal site contained the transit peptides (Mullineaux et al., 1998; Lin et al., 1999; Mayer et al., 1999). Arabidopsis GPX2 and GPX4 were reported to be 169 and 170 residues, respectively with cytosolic localization: thereby, they did not contain any transit peptide (Lin et al., 1999). Arabidopsis GPX3 and GPX6 were 206 and 232 residues, respectively, with mitochondrial localizations; the first 1–12 amino acids in GPX3 and 1–54 residues in GPX6 covered the transit peptide (Lin et al., 1999; Mayer et al., 1999). Arabidopsis GPX5 was 173 residues with probable ER or Plasma membrane localization, without transit peptide (Erfle et al., 2000). Arabidopsis GPX8 comprised of 167 amino acids with cytosolic or nuclear localization, without transit peptide (Theologis et al., 2000). In the present study, alignment analysis revealed that in chloroplastic/mitochondrial-related GPXs, the transit peptide sequences formed the first 50–90 amino acid residues from the N-terminal site while in extra cellular/plasma membrane-related GPXs, residues of the first 20–50 amino acid from N-terminal region contained the putative transit peptide. However, cytosolic sequences lacked of any putative transit residues (Supplementary Figure S1). Thus, analyzed GPX sequences were roughly categorized in three main groups based on their sequence length; the chloroplastic/mitochondrial related GPXs comprised the longer sequences (i), extra cellular/plasma membrane related GPXs formed the medium-sized sequences (ii), and cytosolic related GPXs included the shorter sequences (iii). In addition, the regions corresponding to the transit peptide sites in analyzed sequences did not demonstrate any particular patterns. The less-conserved transit peptide residues could be related with the functional diversities of GPXs at various targets. However, despite the variations in sequence length and transit peptide residues, transcripts of GPX homologs mainly contained the six exons. Therefore, it is reasonable to claim that analyzed GPX sequences could have highly-conserved protein sequences, preserved during the formation of various GPXs. The alignment analysis of 87 GPX protein homologs also confirmed this claim, demonstrating the presence of more conserved residues in the main sites of the active enzyme (Supplementary Figure S2). Moreover, to discern the conserved motif patterns in GPX sequences, the most conserved five motif sequences were searched in sets of 87 GPX homologs using MEME tool (Table 2). Motif 1 and 3 were the 50 amino acid residues, while the motif 2 was 41, motif 4 was 15, and motif 5 was 6 residues in length. Motif 1 and 3 were related with the GSHPx (PF00255) protein family and present in almost all GPX homologs. The presence of long conserved residues and their relation with the GSHPx family could indicate the highly conserved structures of GPX sequences at these sites between/among species.

Table 2

MotifWidthIdentified site no.SequenceProtein domain familya
15087 of 87KYKDQGFEILAFPCNQFGGQEPGTNEEIQQFACTRFKAEYPIFDKVDVNGGSHPx (PF00255)
24187 of 87FGDRIKWNFTKFLVDKEGHVVDRYAPTTSPLQIEKDIQKLLNot found
35086 of 87KSIHDFTVKDIRGNDVDLSIYKGKVLLIVNVASQCGMTNSNYTELNHLYEGSHPx (PF00255)
41587 of 87NAAPLYKFLKSSKWGNot found
5663 of 87MAASHSNot found

Most conserved five motifs of glutathione peroxidase (GPX) homologs in 18 plant species.

a

Protein domain families have been searched in Pfam database.

Furthermore, alignment analysis also demonstrated that Asn (N), Gly (G), Arg (R), Pro (P), Thr (T), Tyr (Y), Lys (K), Ala-Ser (AS), Cys-Gly (CG), Phe-Pro (FP), Glu-Pro (EP), Leu-Lys (LK), Lys-Phe (KF), Asn-Gly (NG), Asn-Gln-Phe (NQF), and Trp-Asn-Phe (WNF) residues were strictly conserved in all aligned sequences, indicating their potential functions in enzyme activity and/or stability (Supplementary Figure S3). To infer a functional relationship between these conserved residues and GPX sequences, we searched for the known catalytic residues of model organism Arabidopsis GPXs in the UniProtKB/Swiss-Prot database of NCBI (www.ncbi.nlm.nih.gov/protein). The following residues were designated in the database as potential catalytic residues for Arabidopsis GPX1-8: GPX1 (Cys-111, Gln-146, Trp-200), GPX2 (Cys-41, Gln-76, Trp-130), GPX3 (Cys-80, Gln-115, Trp-169), GPX4 (Cys-44, Gln-79, Trp-133), GPX5 (Cys-46, Gln-81, Trp-135), GPX6 (Cys-105, Gln-140, Trp-194), GPX7 (Cys-108, Gln-143, Trp-197), and GPX8 (Cys-41, Glu-76, Trp-130). Interestingly, residues that correspond to these catalytic sites in other analyzed sequences were found to be strictly conserved (Supplementary Figure S3). This shows that active sites of the enzyme are considerably conserved between species.

Phylogenetic analysis of GPXs

The evolutionary relationships between identified GPX sequences were analyzed by MEGA 6 using the Maximum Likelihood (ML) method with 1000 bootstraps. The constructed phylogeny included all 87 GPX homologs to discover the phylogenetic distribution of sequences (Figure 1). The tree was divided into six major groups based on the tree topology, and each group was indicated with a different color segment. The red segment included cytosolic, extra cellular, and plasma membrane related GPXs, the green segment contained mitochondrial and chloroplast related GPXs, the blue segment only had cytosolic GPXs, the cyan segment included cytosolic and chloroplast/mitochondrial related GPXs, the yellow segment contained cytosolic/nuclear related GPXs, and the non-colored segment had lower plant Chlamydomonas GPX with a chloroplastic/mitochondrial relation. Annotation of each segment based on the consensus of two subcellular localization servers, CELLO and WoLF PSORT, as well as tree topology for ambiguous sequences. Mainly cytosolic, nuclear, extra cellular and plasma membrane related GPXs were clustered together, while chloroplast/mitochondrial related GPXs also cluster together. Therefore, the presence or absence of transit peptide residues was the main contributing entity in the phylogenetic distribution of GPX sequences. In addition, the presence of sequences with different subcellular localizations in the same group inferred the possibility of gene duplication events in the formation of various GPX sequences. Duplications in plant genomes could be either as small-scale such as tandem and segmental duplications, or as large-scale such as whole-genome duplications (Ramsey and Schemske, 1998). The segmental duplications are observed in different chromosomes whereas tandem duplications occur in the same chromosome (Liu et al., 2011). Several segmental duplications were identified between GPX pairs (Table 3). The presence of segmental duplications, particularly between sequences with various subcellular localizations may partly explain the possibility of gene duplication events in GPX formations.

Figure 1

Table 3

Species nameSegmental duplication pairs
Arabidopsis thaliana (L.) Heynh.AT2G25080-AT4G31870
AT2G48150-AT3G63080
Brachypodium distachyon (L.) P.Beauv.Bradi5g18000-Bradi3g51010
Brasica rapa L.Brara.E00003-Brara.G01994
Brara.I04448-Brara.K00392
Gossypium raimondii Ulbr.Gorai.004G087300-Gorai.006G186100
Gorai.004G211400-Gorai.008G246600
Vitis vinifera L.GSVIVG01019765001-GSVIVG01019766001
Oryza sativa L.LOC_Os04g46960-LOC_Os02g44500
Physcomitrella patens (Hedw.) Bruch & Schimp.Phpat.017G045400-Phpat.004G103100
Prunus persica (L.) Batschppa012416m.g-ppa010771m.g

The segmental duplication events in some glutathione peroxidase (GPX) pairs.

Expression profile analysis of GPXs

The potential expression profile of GPX genes was analyzed at 105 anatomical parts and 10 developmental stage levels using model organism A. thaliana GPXs from Genevestigator platform (Figure 2). Eight Arabidopsis genes, namely GPX1 (AT2G25080), GPX2 (AT2G31570), GPX3 (AT2G43350), GPX4 (AT2G48150), GPX5 (AT3G63080), GPX6 (AT4G11600), GPX7 (AT4G31870), and GPX8 (AT1G63460) were retrieved from the “Affymetrix Arabidopsis ATH1 Genome Array” platform using the Genevestigator interface, and conditions and genes with similar profiles were comparatively analyzed using the Hierarchical clustering tool with the Euclidean distance method. At an anatomical part level (Figure 2A), analyzed GPX1-8 genes were expressed in almost all 105 anatomical tissues in Arabidopsis plants. However, various root and leaf protoplast cells, seed-related tissues, and active growth zones demonstrated significantly higher GPX activity. This indicates that stress factors and/or active metabolism could lead to the up-regulation of various GPX genes in different tissues. Many studies have also showed that balance between production and scavenging of H2O2 could be disturbed by various biotic/abiotic stress factors or perturbations such as drought, salinity, pathogen attack, oxidative state of the cells (Apel and Hirt, 2004; Anjum et al., 2014, 2015; Sofo et al., 2015). Besides, a number of studies were also available demonstrating the functional roles of GPXs in plant stress resistance/tolerance. For example, a GPX gene in Pennisetum glaucum enhanced the drought and salinity stress tolerance (Islam et al., 2015). Citrus GPX3 was reported to be essential in detoxification of ROS-induced cellular stresses as well as in Alternaria alternata pathogenesis (Yang et al., 2016). Silencing of mitochondrial GPX1 in O. sativa demonstrated the impaired photosynthesis in response to salinity (Lima-Melo et al., 2016). Glutathione transferases and peroxidases were reported as key components in Arabidopsis salt stress-acclimation (Horváth et al., 2015). GPX1 and GPX3 in legume root nodules played a protective function against salt stress, oxidative stress, and membrane damage (Matamoros et al., 2015). Therefore, GPXs, which are the antioxidant enzymatic components of the cells, are consequently induced to suppress/eliminate the toxic levels of H2O2. The increased GPX activities in analyzed Arabidopsis tissues could thereby be derived from the increased H2O2 or H2O2-related products. In addition, clustering analysis of GPX genes showed that GPX2, 3, 5, 6, and 8 demonstrate relatively similar expression profiles compared to those of GPX1, 4, and 7. At the developmental level (Figure 2B), the expression profiles of Arabidopsis GPX1-8 genes were analyzed at 10 developmental stages, including senescence, mature siliques, flowers and siliques, developed flower, young rosette, germinated seed, seedling, bolting, young flower, and developed rosette. GPX1-8 were relatively expressed in all developmental stages. However, the expression of GPXs in the senescence stage demonstrated slightly different patterns, particularly the mitochondrial GPX6 gene had the highest expression profile compared to other developmental stages. This may have been caused by senescence-related cellular deteriorations, leading to the substantial metabolic or physiological changes that significantly affect the overall metabolic energy consumption. Therefore, it seems that the expression profiles of GPXs are highly associated with the metabolic state of the cells.

Figure 2

3D structure analysis of GPXs

3D models of putative GPXs were constructed by using Phyre2 server for eight identified Arabidopsis GPX1-8 gene sequences (Figure 3). These sequences were: AT2G25080.1 (GPX1), AT2G31570.1 (GPX2), AT2G43350.1 (GPX3), AT2G48150.1 (GPX4), AT3G63080.1 (GPX5), AT4G11600.1 (GPX6), AT4G31870.1 (GPX7), and AT1G63460.1 (GPX8). In modeling, three templates such as 2F8A:A (GPX1, GPX3, GPX6, and GPX7), 2V1M:A (GPX2 and GPX5), and 2P5Q:A (GPX4 and GPX8) were used to maximize the alignment coverage, percentage identity and confidence for submitted sequences. Predicted models demonstrated the ≥98% of residues in allowed region in Ramachandran plot analysis, indicating that constructed models were fairly in good quality. To find out the structural divergence/similarity in generated models, the structures were superposed to calculate the percentage of structural overlap and RMSD values (Table 4). GPX1-GPX3, GPX4-GPX8, and GPX6-GPX7 pairs demonstrated the highly conserved structural overlap (100%) with 0.14, 0.00, and 0.03 RMSD values, respectively. The each designated pair also belonged to either chloroplastic/mitochondrial or cytosolic form, indicating their functional similarities with minor specifications. In addition, GPX1-GPX6 and 7, GPX2-GPX5, and GPX3-GPX6 and 7 pairs showed very high structural similarity with ≥94 structural overlaps. Despite the highly conserved structures of Arabidopsis GPX members, some minor variations were also present. It seems that these divergences in GPXs may not change the protein-3D structure, however, they could attribute the new functional roles to catalytic activities.

Table 4

GPX1GPX2GPX3GPX4GPX5GPX6GPX7GPX8
GPX188.68/1.03100.00/0.1491.19/1.1089.94/0.9194.34/0.2494.34/0.2491.19/1.10
GPX288.05/0.8988.68/0.9393.75/0.6699.38/0.1591.82/0.9291.82/0.9294.38/0.71
GPX3100.00/0.1489.94/1.1090.57/0.9090.57/0.9594.34/0.2894.34/0.2890.57/0.90
GPX489.94/1.0793.75/0.6791.19/0.9695.65/0.6794.97/0.9794.97/0.97100.00/0.00
GPX590.57/0.8999.38/0.1590.57/0.9195.65/0.6694.34/0.9194.34/0.9195.65/0.67
GPX694.34/0.2492.45/1.0494.34/0.2895.60/1.0794.97/1.04100.00/0.0395.60/1.06
GPX794.34/0.2492.45/1.0594.34/0.2895.60/1.0694.97/1.04100.00/0.0395.60/1.06
GPX891.19/0.9995.00/0.7591.19/0.98100.00/0.0095.65/0.6794.97/0.9794.97/0.97

Structural overlap (%)/RMSD values in superposed Arabidopsis glutathione peroxidases (GPXs).

Red-color highlighted pairs show the highly conserved structural overlaps.

Figure 3

Interaction partner analysis of GPXs

The interactome network was constructed for 10 putative interactors of Arabidopsis cytosolic GPX2, using Cytoscape with STRING data (Figure 4). APX1 (L-ascorbate peroxidase), GSH2 (glutathione synthetase), GSTF6 (glutathione S-transferase F6), GSTT1 (glutathione S-transferase THETA 1), PER1 (1-Cys peroxiredoxin PER1), AT1G65820 (glutathione S-transferase), GSTF12 (glutathione S-transferase phi 12), GSTF2 (glutathione S-transferase F2), GSTF8 (glutathione S-transferase F8), and GSTU19 (glutathione S-transferase U19) proteins were predicted as the main interaction partners of Arabidopsis cytosolic GPX2. APX1 is a type of H2O2-scavenging enzyme and a central component in the reactive oxygen gene network (Storozhenko et al., 1998; Fourcroy et al., 2004). GSH2 involves in the second step of the glutathione synthesis pathway from L-cysteine and L-glutamate (Wang and Oliver, 1996). GSTF6 functions in camalexin biosynthesis, is involved in the conjugation of reduced glutathione to various exogenous/endogenous hydrophobic electrophiles, and has a detoxification role for certain herbicides (Su et al., 2011). GSTT1, GSTF8, and GSTU19 are reported to have glutathione S-transferase or peroxidase activity. They further conjugate the reduced glutathione to various exogenous/endogenous hydrophobic electrophiles and play a detoxification role for certain herbicides (Wagner et al., 2002). PER1 is an antioxidant protein involved in the inhibition of germination under stress (Haslekås et al., 1998). AT1G65820 is a glutathione S-transferase. GSTF12 is involved in the transport of anthocyanins and proanthocyanidins into the vacuole (Kitamura et al., 2004). GSTF2 plays a role in binding and transport of small bioactive products and defense-related compounds under stress (Smith et al., 2003). The analysis indicated that cytosolic GPX2 enzyme is closely related with various pathways involving in antioxidant and secondary metabolite metabolisms, thereby supporting the functional role of GPXs in H2O2-scavenging and plant defense.

Figure 4

Analysis of APXs

Retrieval of APX genes/proteins

Eight potential Arabidopsis APX protein sequences such as APX1-6, APXT, and APXS, obtained from the UniProtKB / Swiss-Prot database of NCBI, were used as queries in Phytozome database to retrieve the very close homologs of APX sequences in 18 plant species. In the selection of APX homologs from blastp hits, a very strict criterion (only the highest hit sequence) was applied to avoid redundant sequences and alternative splices of the same gene. A total of 120 APX sequences were identified from the protein datasets of 18 plant species. These were 8 genes for A. thaliana, 7 genes for B. distachyon, 8 genes for B. rapa, 4 genes for C. reinhardtii, 5 genes for C. sativus, 7 genes for E. grandis, 7 genes for G. max, 8 genes for G. raimondii, 7 genes for M. truncatula, 6 genes for O. sativa, 6 genes for P. vulgaris, 5 genes for P. patens, 7 genes for P. trichocarpa, 6 genes for P. persica, 7 genes for S. lycopersicum, 8 genes for S. bicolor, 6 genes for V. vinifera, and 8 genes for Z. mays (Table 5). Then, genomic, transcript, CDS, and protein sequences of 120 identified APX sequences were retrieved for further analyses.

Table 5

Species namePhytozome gene IDGene/protein features of GPX sequences
Protein domain familyaDomain family descriptionExon no.Protein lengthMW (KDa)Theor. pILocalization CELLObLocalization WoLF PSORTb
Arabidopsis thaliana (L.) Heynh.AT1G07890Peroxidase (PF00141)Peroxidase825027.55.72CytoCyto
AT1G77490Peroxidase (PF00141)Peroxidase1242646.06.81ChloChlo
AT3G09640Peroxidase (PF00141)Peroxidase925128.05.87CytoCyto
AT4G08390Peroxidase (PF00141)Peroxidase1037240.48.31ChloChlo
AT4G09010Peroxidase (PF00141)Peroxidase1034937.98.59Chlo/MitoChlo
AT4G32320Peroxidase (PF00141)Peroxidase1032936.28.99ChloChlo
AT4G35000Peroxidase (PF00141)Peroxidase928731.56.47CytoCyto
AT4G35970Peroxidase (PF00141)Peroxidase927930.88.80Cyto/NuclCyto
Brachypodium distachyon (L.) P.Beauv.Bradi1g16510Peroxidase (PF00141)Peroxidase925627.75.28CytoCyto
Bradi1g65820Peroxidase (PF00141)Peroxidase925027.45.71CytoCyto
Bradi3g40330Peroxidase (PF00141)Peroxidase1132935.46.36ChloChlo
Bradi3g42340Peroxidase (PF00141)Peroxidase928931.57.70Cyto/ChloCyto
Bradi3g45700Peroxidase (PF00141)Peroxidase1243947.35.61ChloChlo
Bradi5g10490Peroxidase (PF00141)Peroxidase1134537.48.77Chlo/MitoChlo
Bradi5g20670Peroxidase (PF00141)Peroxidase1033336.18.71MitoChlo
Brasica rapa L.Brara.A00250Peroxidase (PF00141)Peroxidase828031.07.69CytoCyto
Brara.A03521Peroxidase (PF00141)Peroxidase925128.16.41CytoCyto
Brara.C02583Peroxidase (PF00141)Peroxidase934837.98.59Chlo/MitoChlo
Brara.G03518Peroxidase (PF00141)Peroxidase1043947.57.70ChloChlo
Brara.I02406Peroxidase (PF00141)Peroxidase1035438.87.12Chlo/MitoChlo
Brara.I05334Peroxidase (PF00141)Peroxidase725027.55.61CytoCyto
Brara.K00318Peroxidase (PF00141)Peroxidase928731.76.67CytoCyto
Brara.K00699Peroxidase (PF00141)Peroxidase1032736.18.72ChloChlo
Chlamydomonas reinhardtii P.A.Dang.Cre02.g087700Peroxidase (PF00141)Peroxidase1032735.68.67Mito/ChloChlo/Mito
Cre05.g233900Peroxidase (PF00141)Peroxidase834736.49.23ChloChlo/Mito
Cre06.g285150Peroxidase (PF00141)Peroxidase733735.18.95Chlo/MitoChlo/Mito
Cre09.g401886Peroxidase (PF00141)Peroxidase1037239.48.63ChloChlo
Cucumis sativus L.Cucsa.060660Peroxidase (PF00141)Peroxidase1141344.87.09ChloChlo
Cucsa.162470Peroxidase (PF00141)Peroxidase824927.37.74Chlo/CytoNucl
Cucsa.213340Peroxidase (PF00141)Peroxidase924927.35.43CytoCyto
Cucsa.311620Peroxidase (PF00141)Peroxidase1136840.27.67ChloChlo
Cucsa.370590Peroxidase (PF00141)Peroxidase928631.46.41CytoCyto
Eucalyptus grandis W. Hill ex MaidenEucgr.A01180Peroxidase (PF00141)Peroxidase924927.46.07CytoCyto
Eucgr.B02456Peroxidase (PF00141)Peroxidase924927.25.29CytoCyto
Eucgr.C01740Peroxidase (PF00141)Peroxidase936939.68.44ChloChlo
Eucgr.F00373Peroxidase (PF00141)Peroxidase1135638.36.50ChloChlo
Eucgr.F04344Peroxidase (PF00141)Peroxidase1244648.28.71ChloChlo
Eucgr.F04344Peroxidase (PF00141)Peroxidase1139742.88.60ChloChlo
Eucgr.I01408Peroxidase (PF00141)Peroxidase928731.56.67Cyto/ChloCyto
Glycine max (L.) Merr.Glyma.04G248300Peroxidase (PF00141)Peroxidase1138641.97.06ChloChlo
Glyma.06G068200Peroxidase (PF00141)Peroxidase1031934.27.56ChloChlo
Glyma.06G114400Peroxidase (PF00141)Peroxidase1243247.07.13ChloChlo
Glyma.11G078400Peroxidase (PF00141)Peroxidase928031.19.08Cyto/MitoCyto
Glyma.12G032300Peroxidase (PF00141)Peroxidase928731.76.27CytoCyto
Glyma.12G073100Peroxidase (PF00141)Peroxidase925027.15.65CytoCyto
Glyma.14G177200Peroxidase (PF00141)Peroxidase1034737.96.76Extr/Mito/ChloChlo
Gossypium raimondii Ulbr.Gorai.002G196800Peroxidase (PF00141)Peroxidase928831.75.64CytoCyto
Gorai.005G254100Peroxidase (PF00141)Peroxidase928831.96.67CytoCyto
Gorai.009G104500Peroxidase (PF00141)Peroxidase925027.55.73CytoCyto
Gorai.009G246900Peroxidase (PF00141)Peroxidase1138541.78.89ChloChlo
Gorai.009G420500Peroxidase (PF00141)Peroxidase925127.86.01CytoCyto
Gorai.010G038200Peroxidase (PF00141)Peroxidase1135538.87.53ChloChlo
Gorai.010G051400Peroxidase (PF00141)Peroxidase1242246.06.77ChloChlo
Gorai.010G115200Peroxidase (PF00141)Peroxidase1033436.28.17ChloChlo
Zea mays L.GRMZM2G004211Peroxidase (PF00141)Peroxidase929032.07.72Cyto/MitoCyto
GRMZM2G006791Peroxidase (PF00141)Peroxidase1245148.95.60ChloChlo
GRMZM2G047968Peroxidase (PF00141)Peroxidase722323.79.01Chlo/CytoMito/Chlo
GRMZM2G054300Peroxidase (PF00141)Peroxidase925027.35.56CytoCyto
GRMZM2G120517Peroxidase (PF00141)Peroxidase1133937.08.86MitoChlo
GRMZM2G137839Peroxidase (PF00141)Peroxidase925027.35.64CytoCyto
GRMZM2G156227Peroxidase (PF00141)Peroxidase1035138.38.62MitoChlo
GRMZM2G460406Peroxidase (PF00141)Peroxidase828931.67.73Cyto/ChloCyto
Vitis vinifera L.GSVIVG01008846001Peroxidase (PF00141)Peroxidase11372407.10ChloChlo
GSVIVG01009079001Peroxidase (PF00141)Peroxidase1034437.46.65Extr/ChloChlo
GSVIVG01024035001Peroxidase (PF00141)Peroxidase928931.77.72Chlo/CytoCyto
GSVIVG01025104001Peroxidase (PF00141)Peroxidase925027.55.71CytoCyto
GSVIVG01025551001Peroxidase (PF00141)Peroxidase925327.95.43CytoCyto
GSVIVG01035858001Peroxidase (PF00141)Peroxidase1033035.96.47Chlo/CytoChlo
Oryza sativa L.LOC_Os02g34810Peroxidase (PF00141)Peroxidase1247851.15.36ChloChlo
LOC_Os04g35520Peroxidase (PF00141)Peroxidase1135938.38.76ChloChlo
LOC_Os04g51300Peroxidase (PF00141)Peroxidase1135338.18.67Mito/ChloChlo
LOC_Os07g49400Peroxidase (PF00141)Peroxidase925127.15.18CytoCyto
LOC_Os08g41090Peroxidase (PF00141)Peroxidase1033135.56.95ChloChlo
LOC_Os08g43560Peroxidase (PF00141)Peroxidase929131.77.74Chlo/Cyto/MitoCyto
Medicago truncatula Gaertn.Medtr3g088160Peroxidase (PF00141)Peroxidase1143647.49.02ChloChlo
Medtr3g088160Peroxidase (PF00141)Peroxidase1038742.08.73ChloChlo
Medtr3g107060Peroxidase (PF00141)Peroxidase1032034.78.08ChloMito/Chlo
Medtr4g061140Peroxidase (PF00141)Peroxidase925027.15.52CytoCyto
Medtr4g073410Peroxidase (PF00141)Peroxidase928731.76.26CytoChlo/Cyto
Medtr5g022510Peroxidase (PF00141)Peroxidase928131.48.74CytoCyto
Medtr5g064610Peroxidase (PF00141)Peroxidase1035338.98.18Mito/NuclChlo
Physcomitrella patens (Hedw.) Bruch & Schimp.Phpat.001G070500Peroxidase (PF00141)Peroxidase1135838.47.56ChloChlo
Phpat.001G104200Peroxidase (PF00141)Peroxidase930032.67.01ChloCyto
Phpat.001G162800Peroxidase (PF00141)Peroxidase244048.28.11ChloChlo
Phpat.017G025400Peroxidase (PF00141)Peroxidase1135738.46.15ChloChlo
Phpat.020G011100Peroxidase (PF00141)Peroxidase925027.65.66CytoCyto
Phaseolus vulgaris L.Phvul.008G176700Peroxidase (PF00141)Peroxidase1034737.66.05Chlo/ExtrChlo
Phvul.009G093000Peroxidase (PF00141)Peroxidase1031734.28.38ChloChlo
Phvul.009G126500Peroxidase (PF00141)Peroxidase1243647.88.67ChloChlo
Phvul.009G126500Peroxidase (PF00141)Peroxidase1138742.48.51ChloChlo
Phvul.011G035000Peroxidase (PF00141)Peroxidase928731.67.10CytoCyto
Phvul.011G071300Peroxidase (PF00141)Peroxidase9250275.54CytoCyto
Populus trichocarpa Torr. & A.Gray ex. Hook.Potri.004G174500Peroxidase (PF00141)Peroxidase928631.56.67CytoCyto
Potri.005G161900Peroxidase (PF00141)Peroxidase1034737.87.59Chlo/MitoChlo
Potri.005G179200Peroxidase (PF00141)Peroxidase1034537.85.98CytoChlo/Mito
Potri.006G132200Peroxidase (PF00141)Peroxidase924927.45.27CytoCyto
Potri.006G254500Peroxidase (PF00141)Peroxidase1033736.78.44ChloChlo
Potri.009G015400Peroxidase (PF00141)Peroxidase924927.35.53CytoCyto
Potri.009G134100Peroxidase (PF00141)Peroxidase928631.47.06CytoCyto
Prunus persica (L.) Batschppa006270mPeroxidase (PF00141)Peroxidase1142045.48.48ChloChlo
ppa008008mPeroxidase (PF00141)Peroxidase1034938.46.09Mito/Chlo/ExtrChlo
ppa009582mPeroxidase (PF00141)Peroxidase928631.46.21CytoCyto
ppa010413mPeroxidase (PF00141)Peroxidase925027.35.76CytoCyto
ppa010426mPeroxidase (PF00141)Peroxidase925027.65.37CytoCyto
ppa015878mPeroxidase (PF00141)Peroxidase1031934.36.24ChloChlo
Sorghum bicolor (L.) MoenchSobic.001G410200Peroxidase (PF00141)Peroxidase925027.25.55CytoCyto
Sobic.002G431100Peroxidase (PF00141)Peroxidase925027.15.18CytoCyto
Sobic.004G175500Peroxidase (PF00141)Peroxidase1347351.15.03ChloChlo
Sobic.006G021100Peroxidase (PF00141)Peroxidase947652.18.97NuclChlo
Sobic.006G084400Peroxidase (PF00141)Peroxidase1134437.28.60Mito/ChloChlo
Sobic.006G204000Peroxidase (PF00141)Peroxidase1139542.98.74Mito/ChloChlo
Sobic.007G177000Peroxidase (PF00141)Peroxidase828931.57.73CytoCyto
Sobic.007G205600Peroxidase (PF00141)Peroxidase1033336.27.58ChloChlo
Solanum lycopersicum L.Solyc01g111510Peroxidase (PF00141)Peroxidase828731.67.10CytoCyto
Solyc04g074640Peroxidase (PF00141)Peroxidase1034537.67.60Chlo/MitoChlo
Solyc06g005150Peroxidase (PF00141)Peroxidase925027.35.86CytoCyto
Solyc06g060260Peroxidase (PF00141)Peroxidase1034537.88.48ChloChlo
Solyc08g059760Peroxidase (PF00141)Peroxidase1032635.45.65ChloChlo
Solyc09g007270Peroxidase (PF00141)Peroxidase925027.65.63CytoCyto
Solyc11g018550Peroxidase (PF00141)Peroxidase1242146.08.20ChloChlo

List of H2O2-scavenging enzyme ascorbate peroxidase (APX) homologs from 18 plant species and their primary gene/protein features.

a

Protein domain families were searched in Pfam database.

b

Cyto, Cytosolic; Chlo, Chloroplastic; Mito, Mitochondrial; Nucl, Nuclear; Extr, Extracellular.

More than one localization specified in a single column also shows the significance of other entries in order.

Sequence analysis of APX genes/proteins

A total of 120 APX homologs were identified in protein datasets of 18 plant species using Arabidopsis APX1-6, APXT, and APXS sequences by homology search. Identified APX sequences contained the peroxidase (PF00141) protein family domain. They encoded a protein of 197–478 amino acids residues (average length 323.9) and 23.7–52.1 kDa molecular weight with 5.03–9.23 pI value. The sequence variations in analyzed APXs demonstrated a correlation with their putative localizations, thereby indicated the presence of transit residues (Table 5). Molecular cloning studies from A. thaliana have demonstrated that APX1, APX2, and APX6 are polypeptides of 250, 251, and 329 amino acids, respectively, with cytosolic localizations but without transit peptide (Davletova et al., 2005; Jones et al., 2009; Aryal et al., 2011). APX3 and APX5 consisted of 287 and 279 amino acids, respectively, with peroxisomal localizations; however, sites of transit peptide residues are not precisely specified (Panchuk et al., 2002; Narendra et al., 2006; Bienvenut et al., 2012). APX4 is a 349 amino acids protein with chloroplastic localization, including 1–82 residues as transit peptide from the N-terminal site (Kieselbach et al., 2000; Panchuk et al., 2005; Aryal et al., 2011). APXT is a 426 amino acids chloroplastic protein, including 1–78 residues of transit peptide (Theologis et al., 2000; Panchuk et al., 2005). APXS consists of 372 amino acids with chloroplastic and/or mitochondrial localizations, but the exact site of the transit peptide is not specified (Jespersen et al., 1997; Mayer et al., 1999; Chew et al., 2003). In the present study, multiple-alignment of APX sequences revealed that chloroplastic/mitochondrial-related APXs contained the transit peptide residues in approximately 1–90 amino acids from the N-terminal site while cytosolic APXs did not have any putative transit peptide (Supplementary Figure S4). Thus, the analyzed APX sequences were gathered in two main groups based on subcellular localizations, such as chloroplastic/mitochondrial APXs (i) and cytosolic APXs (ii).

In addition, the regions corresponding to the transit peptide sites in analyzed sequences did not demonstrate any particular pattern. This could indicate that less conservancy in transit peptides may be associated with the functional diversities of APXs at various targets. Besides, APX transcripts mainly consisted of 8–12 exons, supporting the relatively less conserved structure of APXs compared to GPXs. However, alignment analysis also demonstrated the presence of a considerable degree of conserved residues in the main sites of enzyme (Supplementary Figure S5). Moreover, to analyze the availability of any conserved motif pattern/s in APX sequences, the most conserved five motif sequences of APX homologs were searched using MEME tool (Table 6). Motif 1 was 29 residues long, motif 2 and 4 were 21 residues, motif 3 was 32 residues, and motif 5 was 25 residues in length. However, only motifs 2 and 3 had a relation with the peroxidase (PF00141) protein family, and in this case were present in most of the sequences. This could indicate the highly conserved structures of APX sequences at those sites with peroxidase activity.

Table 6

MotifWidthIdentified site no.SequenceProtein domain familya
129120 of 120CHPIMLRLAWHDAGTYDKNTKTWGPNGSINot found
221101 of 120MGLNDQDIVALSGGHTLGRCHPeroxidase (PF00141)
332119 of 120IITYADLYQLAGVVAVEVCGGPTIPMHCGRNDPeroxidase (PF00141)
421118 of 120DPEFRPWVEKYAEDQDAFFRDNot found
52584 of 120ERSGFEQPWTVNWLKFDNSYFKEILNot found

Most conserved five motifs of ascorbate peroxidase (APX) homologs in 18 plant species.

a

Protein domain families have been searched in Pfam database.

Furthermore, alignment analysis also demonstrated that Asp (D) and Gly-Gly (GG) residues are strictly conserved in all aligned sequences, indicating their potential functions in enzyme activity and/or stability (Supplementary Figure S6). To infer a functional relationship between these conserved residues and APX sequences, we searched for the known binding residues of model organism Arabidopsis APXs in the UniProtKB database (http://www.uniprot.org/uniprot/). The following residues were reported as potential active and metal binding residues for Arabidopsis GPX1-6, APXT, and APXS: APX1 (Arg-38, His-42, His-163, Thr-164, Thr-180, Asn-182, Ile-185, Asp-187), APX2 (Arg-39, His-43, His-163, Thr-164, Thr-180, Asn-182, Ile-185, Asp-187), APX3 (Arg-36, His-40, His-160, Thr-161, Thr-177, Asp-184), APX5 (Arg-35, His-39, His-158, Thr-159, Thr-175, Asp-182), APX6 (Arg-119, His-123, His-224), APXT (Arg-108, His-112, His-241, Thr-242, Thr-274, Asp-281), and APXS (Arg-129, His-133, His-262, Thr-263, Thr-295, Asp-302). These active and metal binding residues did not correspond to any of the strictly conserved residues in analyzed APX sequences but they were found to be conserved at considerable rates. However, when taken into consideration that some of the strictly conserved residues in analyzed GPX sequences correspond to the catalytic sites of the enzymes, we can make an inference that these strictly conserved residues in APX sequences may also be associated with the peroxidase activity of the enzyme.

Phylogenetic analysis of APXs

To analyze the evolutionary relationship between identified APX homologs, the phylogenetic tree was constructed by MEGA 6 using the Maximum Likelihood (ML) method with 1000 bootstraps (Figure 5). The constructed tree was divided into five major groups based on the tree topology, and each group was indicated with a different color segment. Blue, red, and green segments included the chloroplast/mitochondria-related APXs with relatively longer, medium and short sequences, respectively, whereas cyan and yellow segments mainly contained longer and shorter cytosolic APX sequences, respectively. Annotation of each segment was based on the consensus of two subcellular localization servers, CELLO and WoLF PSORT, as well as tree topology for ambiguous sequences. Overall, it was observed that cytosolic-related APXs clustered together, while alternatively chloroplast/mitochondrial-related APXs were together. In addition, in clustering of sequences at sub-branches was primarily based on the sequence length and monocot/dicot separation. However, there were considerable variations between sequences, even those belonging to the same subcellular localization. It is thought that these sequence variations could be attributed to the various functional diversities of APXs and/or be associated with different subcellular localizations. Moreover, some sequences were also available with different subcellular localizations in the same clade, indicating the possibility of gene duplication events in formation of some APX genes. The gene duplication events were searched based on the previously designated protocol (Gu et al., 2002). In doing so, several segmental and tandem duplications were identified between some APX pairs (Table 7). The identified segmental or tandem duplications in APX genes were observed between either chloroplastic and chloroplastic, or cytosolic and cytosolic forms. This could indicate the possibility of gene duplication events in the formation of close APX homologs.

Table 7

Duplication typeSpecies nameDuplicated pairs
Segmental duplication PairsBrachypodium distachyon (L.) P.Beauv.Bradi5g10490-Bradi3g45700
Eucalyptus grandis W. Hill ex MaidenEucgr.A01180-Eucgr.B02456
Glycine max (L.) Merr.Glyma.06G114400-Glyma.04G248300
Glyma.11G078400-Glyma.12G032300
Gossypium raimondii Ulbr.Gorai.002G196800-Gorai.005G254100
Gorai.009G246900-Gorai.010G051400
Vitis vinifera L.GSVIVG01025104001-
GSVIVG01025551001
Oryza sativa L.LOC_Os04g35520-LOC_Os02g34810
Populus trichocarpa Torr. & A.Gray ex. Hook.Potri.004G174500-Potri.009G134100
Potri.006G132200-Potri.009G015400
Prunus persica (L.) Batschppa010431m.g-ppa010426m.g
Sorghum bicolor (L.) MoenchSobic.001G410200-Sobic.002G431100
Sobic.006G084400-Sobic.004G175500
Sobic.007G177000-Sobic.006G021100,
Solanum lycopersicum L.Solyc06g005150.2-Solyc09g007270.2
Solyc06g060260.2-Solyc11g018550.2
Tandem duplication PairsBrachypodium distachyon (L.) P.Beauv.Bradi1g16510-Bradi1g65820
Gossypium raimondii Ulbr.Gorai.009G104500-Gorai.009G420500
Zea mays L.GRMZM2G006791-GRMZM2G120517
GRMZM2G054300-GRMZM2G137839

The segmental and tandem duplications in some ascorbate peroxidase (APX) pairs.

Figure 5

Expression profile analysis of APXs

The gene expression profiles of APXs were analyzed at 105 anatomical parts and 10 developmental stage levels using model organism A. thaliana APXs from Genevestigator platform (Figure 6). Eight Arabidopsis genes, namely APX1 (AT1G07890), APX2 (AT3G09640), APX3 (AT4G35000), APX4 (AT4G09010), APX5 (AT4G35970), APX6 (AT4G32320), TAPX (AT1G77490), and SAPX (AT4G08390), were retrieved from the “Affymetrix Arabidopsis ATH1 Genome Array” platform using the Genevestigator interface. Thereafter, conditions and genes with similar profiles were comparatively analyzed using Hierarchical clustering tool with Euclidean distance method.

Figure 6

At the anatomical level (Figure 6A), APX genes were expressed in almost all analyzed tissues of Arabidopsis with various folds. It was clear that the expression levels of genes were closely related with the expressed tissue type/s. For example, both cytosolic APX1 and chloroplastic/mitochondrial SAPX had significantly higher expression in actively growing zones, as well as many root and root protoplast-related structures. APX3, APX4, APX6, and TAPX were expressed in various shoot, bud, leaf, flower and seed related tissues at considerable rates. All these indicated that stress factors, actively growing tissues as well as normal physiological and metabolic changes could induce the expression of APX genes in tissue-dependent way. All these metabolic activities or their related consequences could exert the stresses to the cells. Many studies have further demonstrated that abiotic/abiotic stress factors such as heavy metal, drought, water, heat, cellular H2O2 level, oxidative state of the cell could increase the expression of APX genes to either suppress or eliminate the stressors (Ishikawa and Shigeoka, 2008; Koussevitzky et al., 2008; Yang et al., 2008; Petrov and Van Breusegem, 2012). For example, overexpression of Solanum melongena APX6 in transgenic O. sativa seedlings demonstrated high flood tolerance, reduced oxidative injury and fast plant growth rates (Chiang et al., 2015a). APX regulation by nitric oxide (NO) as a redox indicator in oxidative stress or as part of hormone induced signaling pathway in lateral root development were demonstrated (Correa-Aragunde et al., 2015). S-nitrosylation of Arabidopsis APX1 at Cys32 increased the H2O2 scavenging activity of enzyme, resulting in improved oxidative stress tolerance (Yang et al., 2015). Overexpression of APX and Cu/Zn SOD increased the drought resistance and recovery capacity from drought stress in Ipomoea batatas (Lu et al., 2015). Overexpressed Brassica campestris APX gene in transgenic Arabidopsis enhanced the heat tolerance via elimination of H2O2 (Chiang et al., 2015b). Therefore, increased APX activity in cells is an indicator of the presence of stress factors. At the developmental level (Figure 6B), the expression profile of Arabidopsis APXs was analyzed at 10 developmental stages: senescence, mature siliques, flowers and siliques, developed flower, young rosette, germinated seed, seedling, bolting, young flower, and developed rosette. In all developmental stages, APXs were relatively expressed. However, the expression pattern in senescence was slightly different from other developmental stages, notably cytosolic APX6 showed the highest expression. Interestingly, the Arabidopsis GPX6 gene also demonstrated the highest expression fold at senescence stage, inferring the possibility of functional similarities of these two enzymes. Overall, the expression profile and fold of APXs in various tissues and stages show that cells are constantly put under stress even with normal physiological and metabolic changes, requiring plants to eliminate these stressors.

3D structure analysis of APXs

3D models of eight identified Arabidopsis APX sequences were constructed by using Phyre2 server (Figure 7). The modeled sequences were AT1G07890.1 (APX1), AT3G09640.1 (APX2), AT4G35000.1 (APX3), AT4G09010.1 (APX4), AT4G35970.1 (APX5), AT4G32320.1 (APX6), AT1G77490.1 (APXT), and AT4G08390.1 (APXS). In modeling, six templates such as 1APX:A (APX1), 1OAF:A (APX2, APX3 and APX5), 3RRW:B (APX4), 1BGP:A (APX6), 1ITK:B (APXT), and 1IYN:A (APXS) were used to maximize the alignment coverage, percentage identity, and confidence for the submitted sequences. Predicted models showed the ≥96% of residues were within the allowed region in Ramachandran plot, indicating that structures were acceptably high in quality. To analyze the divergence or similarity in generated models, the structures were superposed in order to calculate the percentage of structural overlap and RMSD values (Table 8). The superposition of APX sequences demonstrated that APX2-APX3, APX2-APX5, and APX3-APX5 pairs have highly conserved structural overlap (100%) with 0.00, 0.38, and 0.38 RMSD values, respectively. These conserved pairs primarily shared the cytosolic and/or peroxisomal localizations, inferring the possibility of a functional relationship between them. In addition, the APX1-APX2, 3, and 5 pairs had very high structural similarity with ≥99 structural overlaps. Therefore, it could be deduced that APX members topologically demonstrated highly conserved structures, despite their functional diversities in different cellular compartments.

Table 8

APX1APX2APX3APX4APX5APX6APXSAPXT
APX199.19/0.4399.59/0.4175.10/1.7599.58/0.5181.53/1.5295.18/0.9589.16/1.49
APX299.19/0.41100.00/0.0075.0071.78100.00/0.3881.45/1.5895.16/0.8687.90/1.35
APX399.59/0.41100.00/0.0075.31/1.85100.00/0.3882.30/1.5697.12/0.8688.48/1.38
APX475.10/1.7575.40/1.7373.66/1.9173.22/1.9272.29/1.8875.79/1.7266.27/1.83
APX599.58/0.48100.00/0.38100.00/0.3874.48/1.8581.17/1.6797.49/0.9089.12/1.31
APX682.73/1.5782.26/1.7083.13/1.6869.88/1.8284.10/1.7081.12/1.5073.90/1.66
APXS95.18/1.0095.97/0.9797.12/1.0075.00/1.7397.49/1.0582.73/1.5583.52/1.38
APXT87.55/1.4789.52/1.3689.71/1.3267.46/1.8790.79/1.3274.70/1.8082.42/1.34

Structural overlap (%)/RMSD values in superposed Arabidopsis ascorbate peroxidases (APXs).

Red-color highlighted pairs show the highly conserved structural overlaps.

Figure 7

Interaction partner analysis of APXs

The interactome network was constructed for 10 putative interactors of Arabidopsis cytosolic APX1 using Cytoscape with STRING data (Figure 8). MDHAR (monodehydroascorbate reductase), GPX2 (glutathione peroxidase 2), DHAR1 (dehydroascorbate reductase), MDAR1 (monodehydroascorbate reductase 1), RHL41 (zinc finger protein ZAT12), ATPQ (ATP synthase subunit d), FBP (fructose-1,6-bisphosphatase), ATMDAR2 [monodehydroascorbate reductase (NADH)], CYTC-1 (cytochrome c-1), and CYTC-2 (cytochrome c-2) proteins were predicted as the main interaction partners of Arabidopsis cytosolic APX1. MDHAR, MDAR1 and ATMDAR2 catalyze the conversion of monodehydroascorbate to ascorbate (Chew et al., 2003). GPX2 is a type of H2O2-scavenging enzyme and a crucial component in reactive oxygen network (Tanaka et al., 2005). DHAR1 has dual functions: soluble protein, it demonstrates GSH-dependent thiol transferase and dehydroascorbate (DHA) reductase activities, and is involved in redox homeostasis. As a peripheral membrane protein, it functions as voltage-gated ion channel (Dixon et al., 2002; Sasaki-Sekimoto et al., 2005). RHL41 affects in modulation of light acclimation, and cold and oxidative stress responses (Rizhsky et al., 2004; Davletova et al., 2005). ATPQ functions in ATP production (Carraro et al., 2014). FBP is reported to be a key component in photosynthetic sucrose synthesis (Cho et al., 2012). CYTC-1 and CYTC-2 are electron carrier proteins related with mitochondrial electron transport chain (Welchen and Gonzalez, 2005). In light of putative interaction partner analysis, it was apparent that Arabidopsis cytosolic APX1 is either directly or indirectly associated with redox homeostasis, stress adaptation and photosynthesis/respiration-related pathways. This could also help in better understanding the functional role of APX1 in various plant defense mechanisms.

Figure 8

Comparison of APX and GPX sequences

A strict homology search of Arabidopsis GPX1-8 sequences in proteome datasets of 18 specified plant species has given a total of 87 putative GPX sequences; however, homology search of Arabidopsis APX1-6, APXT, and APXS in proteome datasets of these species identified a total of 120 putative APXs (Tables 1, 5). Sequences of GPX homologs contained the GPX (PF00255) protein family domain while APX homologs included the peroxidase (PF00141) domain. GPX genes encoded a protein of 166–262 residues with 18.4–29.7 kDa molecular weight and 4.59–9.60 pI value, while APXs encoded a polypeptide of 197–478 residues with 23.7–52.1 kDa molecular weight and 5.03–9.23 pI value. GPX transcripts mainly contained six exons; whereas, APX usually had 8–12 exons, implicating the relatively less conserved structure of APXs compared to GPXs. Sequence variations in GPX and APX homologs primarily derived from the “transit peptide” residues between organelle and non-organelle related sequences. Besides, regions corresponding to transit peptide sites in APX/GPX sequences did not demonstrate any particular pattern, indicating the less conserved structure of transit peptides thereby the functional diversities of APXs/GPXs at various targets. In addition, multiple-alignment analyses demonstrated the presence of a considerable degree of conserved residues in main sites of both enzymes. In GPX phylogeny, cytosolic-, nuclear-, extra cellular,- and plasma membrane-related GPXs were relatedly clustered while chloroplast/mitochondrial-related GPXs grouped together. APX phylogeny also showed similar clustering pattern, in which cytosolic-related APXs were relatedly clustered while chloroplast/mitochondrial-related APXs were together. This indicates that presence/absence of “transit peptide” residues was the main determinant in phylogenetic distribution of APX/GPX sequences. Moreover, presence of sequences with different subcellular localizations in the same phylogenetic group inferred the possibility of gene duplication events in formation of some APX/GPX sequences. Several segmental duplications were identified in some GPX pairs, while several segmental and tandem duplications were available in some APX pairs. Expression profiles of GPX and APX genes in model organism Arabidopsis indicated that stress factors, actively growing tissues, even normal physiological, and metabolic changes could induce the expression of APX/GPX genes. Interactome analyses of Arabidopsis cytosolic APX1 and GPX2 also implicated that both enzymes are closely related with antioxidant and redox homeostasis, secondary metabolite metabolisms and stress adaptation thereby supporting the functional roles of APXs/GPXs in H2O2-scavenging and plant defense. Despite of some minor variations, APX and GPX members, they topologically demonstrated highly conserved structure.

Conclusions

The presence or absence of transit peptide residues are the main contributing factors in subcellular localization and phylogenetic distribution of APX/GPXs. The APX/GPX expression is highly associated with the metabolic state of the cells. In addition, there are grounds for belief that these two enzymes work together in various pathways such as antioxidant and secondary metabolite metabolisms, redox homeostasis, stress adaptation, and photosynthesis/respiration. This also supports the functional role of these enzymes in H2O2-scavenging, thereby implicating their importance in the plant defense. However, further molecular and physiological studies are required to elucidate the various functional roles of APX/GPX isoforms.

Statements

Author contributions

IK and EF contributed to the study conception and design. KK performed experiments and collected data. Data analysis and interpretation were performed by RV. IK, EF, KK, and RV prepared, and NA performed critical reading and revision of the manuscript. IO and EF supervised and MO coordinated this work. All the authors read and approved the final version.

Acknowledgments

NA gratefully acknowledges the partial financial supports received from FCT (Government of Portugal) through contract (SFRH/BPD/84671/2012), the Aveiro University Research Institute/CESAM (UID/AMB/50017/2013), “COMPETE” through Project n.° FCOMP-01-0124-FEDER-02800 (FCT PTDC/AGR-PRO/4091/2012), and to FCT/MEC through national funds, and the co-funding by the FEDER, within the PT2020 Partnership Agreement and Compete 2020.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Supplementary material

The Supplementary Material for this article can be found online at: http://journal.frontiersin.org/article/10.3389/fpls.2016.00301

References

  • 1

    AnjumN. A.GillS. S.GillR.HasanuzzamanM.DuarteA. C.PereiraE.et al. (2014). Metal/metalloid stress tolerance in plants: role of ascorbate, its redox couple, and associated enzymes. Protoplasma251, 12651283. 10.1007/s00709-014-0636-x

  • 2

    AnjumN. A.SofoA.ScopaA.RoychoudhuryA.GillS. S.IqbalM.et al. (2015). Lipids and proteins - major targets of oxidative modifications in abiotic stressed plants. Environ. Sci. Pollut. Res.22, 40994121. 10.1007/s11356-014-3917-1

  • 3

    ApelK.HirtH. (2004). Reactive oxygen species: metabolism, oxidative stress, and signal transduction. Annu. Rev. Plant Biol.55, 373399. 10.1146/annurev.arplant.55.031903.141701

  • 4

    AryalU. K.KrochkoJ. E.RossA. R. (2011). Identification of phosphoproteins in Arabidopsis thaliana leaves using polyethylene glycol fractionation, immobilized metal-ion affinity chromatography, two-dimensional gel electrophoresis and mass spectrometry. J. Proteome Res.11, 425437. 10.1021/pr200917t

  • 5

    BaileyT. L.BodenM.BuskeF. A.FrithM.GrantC. E.ClementiL.et al. (2009). MEME SUITE: tools for motif discovery and searching. Nucleic Acids Res. 37, 202208. 10.1093/nar/gkp335

  • 6

    BelaK.HorváthE.GalléÁ.SzabadosL.TariI.CsiszárJ. (2015). Plant glutathione peroxidases: emerging role of the antioxidant enzymes in plant development and stress responses. J. Plant Physiol.176, 192201. 10.1016/j.jplph.2014.12.014

  • 7

    BienertG. P.MøllerA. L.KristiansenK. A.SchulzA.MøllerI. M.SchjoerringJ. K.et al. (2007). Specific aquaporins facilitate the diffusion of hydrogen peroxide across membranes. J. Biol. Chem.282, 11831192. 10.1074/jbc.M603761200

  • 8

    BienvenutW. V.SumptonD.MartinezA.LillaS.EspagneC.MeinnelT.et al. (2012). Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-α-acetylation features. Mol. Cell Proteomics11, M111.015131. 10.1074/mcp.m111.015131

  • 9

    CarraroM.GiorgioV.ŠileikytëJ.SartoriG.ForteM.LippeG.et al. (2014). Channel formation by yeast F-ATP synthase and the role of dimerization in the mitochondrial permeability transition. J. Biol. Chem.289, 1598015985. 10.1074/jbc.C114.559633

  • 10

    CaverzanA.PassaiaG.RosaS. B.RibeiroC. W.LazzarottoF.Margis-PinheiroM. (2012). Plant responses to stresses: role of ascorbate peroxidase in the antioxidant protection. Genet. Mol. Biol.35, 10111019. 10.1590/S1415-47572012000600016

  • 11

    ChewO.WhelanJ.MillarA. H. (2003). Molecular definition of the ascorbate-glutathione cycle in Arabidopsis mitochondria reveals dual targeting of antioxidant defenses in plants. J. Biol. Chem.278, 4686946877. 10.1074/jbc.M307525200

  • 12

    ChiangC. M.ChenL. F. O.ShihS. W.LinK. H. (2015a). Expression of eggplant ascorbate peroxidase increases the tolerance of transgenic rice plants to flooding stress. J. Plant Biochem. Biotechnol.24, 257267. 10.1007/s13562-014-0265-7

  • 13

    ChiangC. M.ChienH. L.ChenL. F. O.HsiungT. C.ChiangM. C.ChenS. P.et al. (2015b). Overexpression of the genes coding ascorbate peroxidase from Brassica campestris enhances heat tolerance in transgenic Arabidopsis thaliana. Biol. Plant59, 305315. 10.1007/s10535-015-0489-y

  • 14

    ChoM. H.JangA.BhooS. H.JeonJ. S.HahnT. R. (2012). Manipulation of triose phosphate/phosphate translocator and cytosolic fructose-1, 6-bisphosphatase, the key components in photosynthetic sucrose synthesis, enhances the source capacity of transgenic Arabidopsis plants. Photosynth. Res.111, 261268. 10.1007/s11120-012-9720-2

  • 15

    Correa-AragundeN.ForesiN.LamattinaL. (2015). Nitric oxide is an ubiquitous signal for maintaining redox balance in plant cells: regulation of ascorbate peroxidase as a case study. J. Exp. Bot. 66, 29132921. 10.1093/jxb/erv073

  • 16

    CriquiM. C.JametE.ParmentierY.MarbachJ.DurrA.FleckJ. (1992). Isolation and characterization of a plant cDNA showing homology to animal glutathione peroxidases. Plant Mol. Biol.18, 623627. 10.1007/BF00040684

  • 17

    DavletovaS.RizhskyL.LiangH.ShengqiangZ.OliverD. J.CoutuJ.et al. (2005). Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis. Plant Cell17, 268281. 10.1105/tpc.104.026971

  • 18

    DiaoY.XuH.LiG.YuA.YuX.HuW.et al. (2014). Cloning a glutathione peroxidase gene from Nelumbo nucifera and enhanced salt tolerance by overexpressing in rice. Mol. Biol. Rep.41, 49194927. 10.1007/s11033-014-3358-4

  • 19

    DietzK. J. (2011). Peroxiredoxins in plants and cyanobacteria. Antiox. Redox Signal.15, 11291159. 10.1089/ars.2010.3657

  • 20

    DixonD. P.DavisB. G.EdwardsR. (2002). Functional divergence in the glutathione transferase superfamily in plants identification of two classes with putative functions in redox homeostasis in Arabidopsis thaliana. J. Biol. Chem.277, 3085930869. 10.1074/jbc.M202919200

  • 21

    DynowskiM.SchaafG.LoqueD.MoranO.LudewigU. (2008). Plant plasma membrane water channels conduct the signalling molecule H2O2. Biochem. J.414, 5361. 10.1042/BJ20080287

  • 22

    ErfleH.VentzkiR.VossH.RechmannS.BenesV.StegemannJ.et al. (2000). Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana. Nature408, 820822. 10.1038/35048706

  • 23

    Ferreira NetoJ. R. C.PandolfiV.GuimaraesF. C. M.Benko-IsepponA. M.RomeroC.De Oliveira SilvaR. L.et al. (2013). Early transcriptional response of soybean contrasting accessions to root dehydration. PLoS ONE8:e83466. 10.1371/journal.pone.0083466

  • 24

    FinnR. D.CoggillP.EberhardtR. Y.EddyS. R.MistryJ.MitchellA. L.et al. (2016). The Pfam protein families database: towards a more sustainable future. Nucleic Acids Res.44, D279D285. 10.1093/nar/gkv1344

  • 25

    FourcroyP.VansuytG.KushnirS.InzéD.BriatJ. F. (2004). Iron-regulated expression of a cytosolic ascorbate peroxidase encoded by the APX1 gene in Arabidopsis seedlings. Plant Physiol.134, 605613. 10.1104/pp.103.029876

  • 26

    FranceschiniA.SzklarczykD.FrankildS.KuhnM.SimonovicM.RothA.et al. (2013). STRING v9. 1: protein-protein interaction networks, with increased coverage and integration. Nucleic Acids Res.41, 808815. 10.1093/nar/gks1094

  • 27

    FuJ. Y. (2014). Cloning of a new glutathione peroxidase gene from tea plant (Camellia sinensis) and expression analysis under biotic and abiotic stresses. Bot. Stud.55:7. 10.1186/1999-3110-55-7

  • 28

    GaoF.ChenJ.MaT.LiH.WangN.LiZ.et al. (2014). The glutathione peroxidase gene family in Thellungiella salsuginea: genome-wide identification, classification, and gene and protein expression analysis under stress conditions. Int. J. Mol. Sci.15, 33193335. 10.3390/ijms15023319

  • 29

    GasteigerE.HooglandC.GattikerA.DuvaudS.WilkinsM. R.AppelR. D.et al. (2005). Protein identification and analysis tools on the ExPASy server, in The Proteomics Protocols Handbook, ed WalkerJ. M. (Totowa, NJ: Humana), 571607.

  • 30

    GoodsteinD. M.ShuS.HowsonR.NeupaneR.HayesR. D.FazoJ.et al. (2012). Phytozome: a comparative platform for green plant genomics. Nucleic Acids Res.40, D1178D1186. 10.1093/nar/gkr944

  • 31

    GuZ.CavalcantiA.ChenF. C.BoumanP.LiW. H. (2002). Extent of gene duplication in the genomes of Drosophila, nematode, and yeast. Mol. Biol. Evol.19, 256262. 10.1093/oxfordjournals.molbev.a004079

  • 32

    HaslekåsC.StacyR. A.NygaardV.Culiáñez-MaciàF. A.AalenR. B. (1998). The expression of a peroxiredoxin antioxidant gene, AtPer1, in Arabidopsis thaliana is seed-specific and related to dormancy. Plant Mol. Biol. 36, 833845.

  • 33

    HerbetteS.de LabrouheD. T.DrevetJ. R.Roeckel-DrevetP. (2011). Transgenic tomatoes showing higher glutathione peroxydase antioxidant activity are more resistant to an abiotic stress but more susceptible to biotic stresses. Plant Sci.180, 548553. 10.1016/j.plantsci.2010.12.002

  • 34

    HortonP.ParkK. J.ObayashiT.FujitaN.HaradaH.Adams-CollierC. J.et al. (2007). WoLF PSORT: protein localization predictor. Nucleic Acids Res. 35, W585W587. 10.1093/nar/gkm259

  • 35

    HorváthE.BrunnerS.BelaK.PapdiC.SzabadosL.TariI.et al. (2015). Exogenous salicylic acid-triggered changes in the glutathione transferases and peroxidases are key factors in the successful salt stress acclimation of Arabidopsis thaliana. Funct. Plant Biol.42, 11291140. 10.1071/FP15119

  • 36

    HossainM. A.BhattacharjeeS.ArminS. M.QianP.XinW.LiH. Y.et al. (2015). Hydrogen peroxide priming modulates abiotic oxidative stress tolerance: insights from ROS detoxification and scavenging. Front. Plant. Sci.6:420. 10.3389/fpls.2015.00420

  • 37

    HruzT.LauleO.SzaboG.WessendorpF.BleulerS.OertleL.et al. (2008). Genevestigator v3: a reference expression database for the meta-analysis of transcriptomes. Adv. Bioinformatics2008:420747. 10.1155/2008/420747

  • 38

    HuB.JinJ.GuoA. Y.ZhangH.LuoJ.GaoG. (2014). GSDS 2.0: an upgraded gene feature visualization server. Bioinformatics31, 12961297. 10.1093/bioinformatics/btu817

  • 39

    IshikawaT.ShigeokaS. (2008). Recent advances in ascorbate biosynthesis and the physiological significance of ascorbate peroxidase in photosynthesizing organisms. Biosci. Biotechnol. Biochem.72, 11431154. 10.1271/bbb.80062

  • 40

    IshikawaT.YoshimuraK.SakaiK.TamoiM.TakedaT.ShigeokaS.et al. (1998). Molecular characterization and physiological role of a glyoxysome-bound ascorbate peroxidase from spinach. Plant Cell Physiol. 39, 2334. 10.1093/oxfordjournals.pcp.a029285

  • 41

    IslamT.MannaM.ReddyM. K. (2015). Glutathione Peroxidase of Pennisetum glaucum (PgGPx) is a functional Cd 2+ dependent peroxiredoxin that enhances tolerance against salinity and drought stress. PLoS ONE10:e0143344. 10.1371/journal.pone.0143344

  • 42

    JespersenH.KjaersgårdI. V.OstergaardL.WelinderK. G. (1997). From sequence analysis of three novel ascorbate peroxidases from Arabidopsis thaliana to structure, function and evolution of seven types of ascorbate peroxidase. Biochem. J.326, 305310. 10.1042/bj3260305

  • 43

    JonesA. M.MacLeanD.StudholmeD. J.Serna-SanzA.AndreassonE.RathjenJ. P.et al. (2009). Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana. J. Proteomics.72, 439451. 10.1016/j.jprot.2009.02.004

  • 44

    KelleyL. A.SternbergM. J. (2009). Protein structure prediction on the Web: a case study using the Phyre server. Nat. Protoc.4, 363371. 10.1038/nprot.2009.2

  • 45

    KieselbachT.BystedtM.HyndsP.RobinsonC.SchröderW. P. (2000). A peroxidase homologue and novel plastocyanin located by proteomics to the Arabidopsis chloroplast thylakoid lumen. FEBS Lett.480, 271276. 10.1016/S0014-5793(00)01890-1

  • 46

    KitamuraS.ShikazonoN.TanakaA. (2004). TRANSPARENT TESTA 19 is involved in the accumulation of both anthocyanins and proanthocyanidins in Arabidopsis. Plant J. 37, 104114. 10.1046/j.1365-313X.2003.01943.x

  • 47

    KouaD.CeruttiL.FalquetL.SigristC. J.TheilerG.HuloN.et al. (2009). PeroxiBase: a database with new tools for peroxidase family classification. Nucleic Acids Res.37, D261D266. 10.1093/nar/gkn680

  • 48

    KoussevitzkyS.SuzukiN.HuntingtonS.ArmijoL.ShaW.CortesD.et al. (2008). Ascorbate peroxidase 1 plays a key role in the response of Arabidopsis thaliana to stress combination. J. Biol. Chem.283, 3419734203. 10.1074/jbc.m806337200

  • 49

    LazzarottoF.TeixeiraF. K.RosaS. B.DunandC.FernandesC. L.de Vasconcelos FonteneleA.et al. (2011). Ascorbate peroxidase-related (APx-R) is a new heme-containing protein functionally associated with ascorbate peroxidase but evolutionarily divergent. New Phytol.191, 234250. 10.1111/j.1469-8137.2011.03659.x

  • 50

    Lima-MeloY.CarvalhoF. E.MartinsM. O.PassaiaG.SousaR. H.NetoM. C. L.et al. (2016). Mitochondrial GPX1 silencing triggers differential photosynthesis impairment in response to salinity in rice plants. J. Integr. Plant. Biol. [Epub ahead of print]. 10.1111/jipb.12464.

  • 51

    LinX.KaulS.RounsleyS.SheaT. P.BenitoM. I.TownC. D.et al. (1999). Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana. Nature402, 761768. 10.1038/45471

  • 52

    LiuY.JiangH. Y.ChenW.QianY.MaQ.ChengB.et al. (2011). Genome-wide analysis of the auxin response factor (ARF) gene family in maize (Zea mays). Plant Growth Regul. 63, 225234. 10.1007/s10725-010-9519-0

  • 53

    LovellS. C.DavisI. W.ArendallW. B.III.de BakkerP. I.WordJ. M.PrisantM. G.et al. (2003). Structure validation by Cα geometry: φ, ψ and Cβ deviation. Proteins50, 437450. 10.1002/prot.10286

  • 54

    LuY. Y.DengX. P.KwakS. S. (2015). Over expression of CuZn superoxide dismutase (CuZn SOD) and ascorbate peroxidase (APX) in transgenic sweet potato enhances tolerance and recovery from drought stress. Afr. J. Biotechnol.9, 83788391. 10.5897/AJB10.926

  • 55

    MatamorosM. A.SaizA.PeñuelasM.Bustos-SanmamedP.MuletJ. M.BarjaM. V.et al. (2015). Function of glutathione peroxidases in legume root nodules. J. Exp. Bot.66, 29792990. 10.1093/jxb/erv066

  • 56

    MayerK.SchüllerC.WambuttR.MurphyG.VolckaertG.PohlT.et al. (1999). Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana. Nature402, 769777. 10.1038/47134

  • 57

    MillaM. A. R.MaurerA.Rodriguez HueteA.GustafsonJ. P. (2003). Glutathione peroxidase genes in Arabidopsis are ubiquitous and regulated by abiotic stresses through diverse signaling pathways. Plant J.36, 602615. 10.1046/j.1365-313X.2003.01901.x

  • 58

    MittlerR.VanderauweraS.GolleryM.Van BreusegemF. (2004). Reactive oxygen gene network of plants. Trend Plant Sci.9, 490498. 10.1016/j.tplants.2004.08.009

  • 59

    MullineauxP.KarpinskiS. (2002). Signal transduction in response to excess light: getting out of the chloroplast. Curr. Opin. Plant Biol.5, 4348. 10.1016/S1369-5266(01)00226-6

  • 60

    MullineauxP. M.KarpinskiS.JiménezA.ClearyS. P.RobinsonC.CreissenG. P. (1998). Identification of cDNAs encoding plastid−targeted glutathione peroxidase. Plant J.13, 375379. 10.1046/j.1365-313X.1998.00052.x

  • 61

    NajamiN.JandaT.BarriahW.KayamG.TalM.GuyM.et al. (2008). Ascorbate peroxidase gene family in tomato: its identification and characterization. Mol. Genet. Genomics279, 171182. 10.1007/s00438-007-0305-2

  • 62

    NarendraS.VenkataramaniS.ShenG.WangJ.PasapulaV.LinY.et al. (2006). The Arabidopsis ascorbate peroxidase 3 is a peroxisomal membrane-bound antioxidant enzyme and is dispensable for Arabidopsis growth and development. J. Exp. Bot.57, 30333042. 10.1093/jxb/erl060

  • 63

    NavrotN.CollinV.GualbertoJ.GelhayeE.HirasawaM.ReyP.et al. (2006). Plant glutathione peroxidases are functional peroxiredoxins distributed in several subcellular compartments and regulated during biotic and abiotic stresses. Plant Physiol.142, 13641379. 10.1104/pp.106.089458

  • 64

    NegiY. K. (2011). Comparative in silico analysis of ascorbate peroxidase protein sequences from different plant species. J. Bioengg. Biomed. Sci.1, 103. 10.4172/2155-9538.1000103

  • 65

    NguyenM. N.TanK. P.MadhusudhanM. S. (2011). CLICK - topology-independent comparison of biomolecular 3D structures. Nucleic Acids Res.39, W24W28. 10.1093/nar/gkr393

  • 66

    PanchukI. I.VolkovR. A.SchöfflF. (2002). Heat stress-and heat shock transcription factor-dependent expression and activity of ascorbate peroxidase in Arabidopsis. Plant Physiol.129, 838853. 10.1104/pp.001362

  • 67

    PanchukI. I.ZentgrafU.VolkovR. A. (2005). Expression of the Apx gene family during leaf senescence of Arabidopsis thaliana. Planta222, 926932. 10.1007/s00425-005-0028-8

  • 68

    PassaiaG.FoniniL. S.CaverzanA.Jardim-MessederD.ChristoffA. P.GaetaM. L.et al. (2013). The mitochondrial glutathione peroxidase GPX3 is essential for H2O2 homeostasis and root and shoot development in rice. Plant Sci.208, 93101. 10.1016/j.plantsci.2013.03.017

  • 69

    PetrovV. D.Van BreusegemF. (2012). Hydrogen peroxide - a central hub for information flow in plant cells. AoB Plants2012:pls014. 10.1093/aobpla/pls014

  • 70

    RamseyJ.SchemskeD. W. (1998). Pathways, mechanisms, and rates of polyploid formation in flowering plants. Annu. Rev. Ecol. Evol. Syst.29, 467501. 10.1146/annurev.ecolsys.29.1.467

  • 71

    RizhskyL.DavletovaS.LiangH.MittlerR. (2004). The zinc finger protein Zat12 is required for cytosolic ascorbate peroxidase 1 expression during oxidative stress in Arabidopsis. J. Biol. Chem. 279, 1173611743. 10.1074/jbc.M313350200

  • 72

    RomitiM. (2006). Entrez Nucleotide and Entrez Protein FAQs. Entrez Sequences Help.Bethesda, MD: National Center for Biotechnology Information (US). Updated 2010 May 12. Available online at: http://www.ncbi.nlm.nih.gov/books/NBK49541/

  • 73

    RouhierN.JacquotJ.-P. (2005). The plant multigenic family of thiol peroxidases. Free Radical Biol. Med.38, 14131421. 10.1016/j.freeradbiomed.2004.07.037

  • 74

    Sasaki-SekimotoY.TakiN.ObayashiT.AonoM.MatsumotoF.SakuraiN.et al. (2005). Coordinated activation of metabolic pathways for antioxidants and defence compounds by jasmonates and their roles in stress tolerance in Arabidopsis. Plant J. 44, 653668. 10.1111/j.1365-313X.2005.02560.x

  • 75

    SharmaP.DubeyR. S. (2005). Modulation of nitrate reductase activity in rice seedlings under aluminium toxicity and water stress: role of osmolytes as enzyme protectant. J. Plant Physiol.162, 854864. 10.1016/j.jplph.2004.09.011

  • 76

    SmithA. P.NourizadehS. D.PeerW. A.XuJ.BandyopadhyayA.MurphyA. S.et al. (2003). Arabidopsis AtGSTF2 is regulated by ethylene and auxin, and encodes a glutathione S−transferase that interacts with flavonoids. Plant J. 36, 433442. 10.1046/j.1365-313X.2003.01890.x

  • 77

    SmootM. E.OnoK.RuscheinskiJ.WangP. L.IdekerT. (2011). Cytoscape 2.8: new features for data integration and network visualization. Bioinformatics27, 43143210.1093/bioinformatics/btq675

  • 78

    SofoA.ScopaA.NuzzaciM.VittiA. (2015). Ascorbate peroxidase and catalase activities and their genetic regulation in plants subjected to drought and salinity stresses. Intl. J. Mol. Sci.16, 1356113578. 10.3390/ijms160613561

  • 79

    StorozhenkoS.De PauwP.Van MontaguM.InzéD.KushnirS. (1998). The heat-shock element is a functional component of the Arabidopsis APX1 gene promoter. Plant Physiol.118, 10051014. 10.1104/pp.118.3.1005

  • 80

    SuT.XuJ.LiY.LeiL.ZhaoL.YangH.et al. (2011). Glutathione-indole-3-acetonitrile is required for camalexin biosynthesis in Arabidopsis thaliana. Plant Cell23, 364380. 10.1105/tpc.110.079145

  • 81

    SugimotoM.OonoY.GusevO.MatsumotoT.YazawaT.LevinskikhM. A.et al. (2014). Genome-wide expression analysis of reactive oxygen species gene network in Mizuna plants grown in long-term spaceflight. BMC Plant Biol.14:4. 10.1186/1471-2229-14-4

  • 82

    SuzukiN.MittlerR. (2006). Reactive oxygen species and temperature stresses: a delicate balance between signaling and destruction. Physiol. Plant126, 4551. 10.1111/j.0031-9317.2005.00582.x

  • 83

    TamuraK.StecherG.PetersonD.FilipskiA.KumarS. (2013). MEGA6: molecular evolutionary genetics analysis version 6.0. Mol. Biol. Evol.30, 27252729. 10.1093/molbev/mst197

  • 84

    TanakaT.IzawaS.InoueY. (2005). GPX2, encoding a phospholipid hydroperoxide glutathione peroxidase homologue, codes for an atypical 2-Cys peroxiredoxin in Saccharomyces cerevisiae. J. Biol. Chem.280, 4207842087. 10.1074/jbc.M508622200

  • 85

    TeixeiraF. K.Menezes-BenaventeL.GalvãoV. C.MargisR.Margis-PinheiroM. (2006). Rice ascorbate peroxidase gene family encodes functionally diverse isoforms localized in different subcellular compartments. Planta224, 300314. 10.1007/s00425-005-0214-8

  • 86

    TeixeiraF. K.Menezes-BenaventeL.MargisR.Margis-PinheiroM. (2004). Analysis of the molecular evolutionary history of the ascorbate peroxidase gene family: inferences from the rice genome. J. Mol. Evol.59, 761770. 10.1007/s00239-004-2666-z

  • 87

    TheologisA.EckerJ. R.PalmC. J.FederspielN. A.KaulS.WhiteO.et al. (2000). Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana. Nature408, 816820. 10.1038/35048500

  • 88

    ThompsonJ. D.HigginsD. G.GibsonT. J. (1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res.22, 46734680. 10.1093/nar/22.22.4673

  • 89

    UzildayB.TurkanI.OzgurR.SekmenA. H. (2014). Strategies of ROS regulation and antioxidant defense during transition from C3 to C4 photosynthesis in the genus Flaveria under PEG-induced osmotic stress. J. Plant Physiol.171, 6575. 10.1016/j.jplph.2013.06.016

  • 90

    WagnerU.EdwardsR.DixonD. P.MauchF. (2002). Probing the diversity of the Arabidopsis glutathione S-transferase gene family. Plant Mol. Biol.49, 515532. 10.1023/A:1015557300450

  • 91

    WangC. L.OliverD. J. (1996). Cloning of the cDNA and genomic clones for glutathione synthetase fromArabidopsis thaliana and complementation of agsh2 mutant in fission yeast. Plant Mol. Biol.31, 10931104. 10.1007/BF00040827

  • 92

    WelchenE.GonzalezD. H. (2005). Differential expression of the Arabidopsis cytochrome c genes Cytc-1 and Cytc-2. Evidence for the involvement of TCP-domain protein-binding elements in anther-and meristem-specific expression of the Cytc-1 gene. Plant Physiol.139, 88100. 10.1104/pp.105.065920

  • 93

    WelinderK. G. (1992). Superfamily of plant, fungal and bacterial peroxidases. Curr. Opin. Struct. Biol.2, 388393. 10.1016/0959-440X(92)90230-5

  • 94

    YabutaY.YoshimuraK.TakedaT.ShigeokaS. (2000). Molecular characterization of tobacco mitochondrial L-galactono-γ-lactone dehydrogenase and its expression in Escherichia coli. Plant Cell Physiol.41, 666675. 10.1093/pcp/41.6.666

  • 95

    YangH.MuJ.ChenL.FengJ.HuJ.LiL.et al. (2015). S-Nitrosylation positively regulates ascorbate peroxidase activity during plant stress responses. Plant Physiol.167, 16041615. 10.1104/pp.114.255216

  • 96

    YangS. L.YuP. L.ChungK. R. (2016). The glutathione peroxidase-mediated reactive oxygen species resistance, fungicide sensitivity and cell wall construction in the citrus fungal pathogen Alternaria alternata. Environ. Microbiol. [Epub ahead of print]. 10.1111/1462-2920.13125.

  • 97

    YangY.HanC.LiuQ.LinB.WangJ. (2008). Effect of drought and low light on growth and enzymatic antioxidant system of Picea asperata seedlings. Acta Physiol. Plant.30, 433440. 10.1007/s11738-008-0140-z

  • 98

    YuC. S.ChenY. C.LuC. H.HwangJ. K. (2006). Prediction of protein subcellular localization. Proteins64, 643651. 10.1002/prot.21018

Summary

Keywords

ROS, signal transduction, antioxidant, peroxisome, chloroplast, mitochondria

Citation

Ozyigit II, Filiz E, Vatansever R, Kurtoglu KY, Koc I, Öztürk MX and Anjum NA (2016) Identification and Comparative Analysis of H2O2-Scavenging Enzymes (Ascorbate Peroxidase and Glutathione Peroxidase) in Selected Plants Employing Bioinformatics Approaches. Front. Plant Sci. 7:301. doi: 10.3389/fpls.2016.00301

Received

13 January 2016

Accepted

25 February 2016

Published

22 March 2016

Volume

7 - 2016

Edited by

Richard Sayre, New Mexico Consortium at Los Alamos National Labs, USA

Reviewed by

Suleyman I. Allakhverdiev, Russian Academy of Sciences, Russia; Golam Jalal Ahammed, Zhejiang University, China; Yogesh Abrol, Bhagalpur University, India; Kumar Ajit, University of South Australia, Australia

Updates

Copyright

*Correspondence: Ibrahim I. Ozyigit

This article was submitted to Plant Physiology, a section of the journal Frontiers in Plant Science

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics