Abstract
Bacterial diseases cause severe losses in the production and revenue of many fruit crops, including citrus and apple. Huanglongbing (HLB) in citrus and fire blight in apple are two deadly diseases without any cure. In this article, we introduce a novel therapy for HLB and fire blight by enhancing the innate immunity of the host plants. Specifically, we constructed in silico a library of chimeras containing two different host peptides with observed or predicted antibacterial activity. Subsequently, we performed bactericidal and toxicity tests in vitro to select a few non-toxic chimeras with high antibacterial activity. Finally, we conducted ex planta studies to show that not only do the chimeras clear the causative bacteria from citrus leaves with HLB and from apple leaves with fire blight but they also augment the host’s innate immunity during infection. This platform technology can be extended to design host-derived chimeras against multiple pathogenic bacteria that cause diseases in plants and animals of agricultural importance and in humans.
Introduction
The citrus and apple industries provide both fresh and processed fruits to consumers for health and nourishment. However, citrus and apple growers face serious threats from chronic and emerging bacterial diseases. Effective tools are urgently needed for the treatment of bacterial diseases in citrus and apple. Of all citrus diseases, Huanglongbing (HLB) is the most devastating, which is caused by Candidatus Liberibacter asiaticus (CLas), a Gram-negative bacterium (; ; ) transmitted by Diaphorina citri Kuwayama (Asian citrus psyllids, ACP) (). Since its first detection in 2005, the Florida citrus industry has witnessed over an 80% decline in citrus production (). In Texas, HLB was first detected in 2012 (), and by 2017, it was confirmed in 28% of commercial and 40% of residential sites (). In California, so far, only 3,053 isolated HLB cases have been identified and removed as mandated by the state (). Although Florida, California, and Texas, the major citrus-producing states, have experienced different HLB pressures, all of them need effective, safe, and affordable tools to treat and prevent HLB. The current disease management tools consist of insecticide spray to limit the spread of psyllids (; ). Moreover, nutrients, chemicals, and antibiotics have been applied for disease management (; ). Unfortunately, none of these disease management tools provide a cure for HLB. Fire blight, like HLB, is a destructive disease of apples and pears. Fire blight is caused by the bacterium Erwinia amylovora, which infects blossoms, fruits, vegetative shoots, woody tissues, and rootstock crowns (). It is estimated that US apple producers suffer an average annual loss of US $100 million due to fire blight (). The diversity of host tissues susceptible to infection, combined with the limited number of available and effective disease management tools, has made it difficult to stop or slow the progress of fire blight epidemics.
Over a decade ago, we introduced the concept of host-based therapy for the treatment and prevention of bacterial diseases in humans and plants (; ; Vuyisich et al., 2008). The application of this concept was successful in combating diseases caused by intact bacteria or the toxins secreted by them. Subsequently, for the application of host-based therapy, we focused primarily on enhancing the innate immunity of humans and plants, the first line of defense against invading pathogens (). It should be noted that a plant’s innate immune repertoire contains pathogenesis-related (PR) or defense peptides/proteins to clear pathogens or block pathogenesis (). However, the evolution of bacterial resistance often suppresses the action of the PR proteins in host defense (). Therefore, we developed strategies to introduce sequence/structure modifications in the PR peptides/proteins to overcome bacterial resistance while retaining high activity against invading pathogens.
One of the successful applications of our strategy involved the design of helix-turn-helix (HTH) peptides and their use in the treatment of two bacterial diseases, namely, Pierce’s disease (PD) in grape caused by xylem-limited Xylella fastidiosa (Xf) and HLB in citrus caused by phloem-limited CLas (). The HTH peptides were designed by joining two identical helical amphipathic peptides with a sharp type II GPGR turn (; ). While each helix had homologous segments in grape and citrus proteins, the whole length of the artificially constructed HTH peptides showed very little homology with any grape or citrus protein segment. Therefore, we performed toxicity assays to verify that the HTH peptides are not toxic to plant leaves or human cells at the active dose (). In field trials, two HTH peptides (peptide names: 28P-2 and 36P-1) showed efficacy for the treatment of PD in grapevines and HLB in citrus (). Laboratory studies revealed that 36P-1 was 14 times more active on CLas than 28P-2 (). However, 36P-1 appeared toxic at the treatment dose, which required appropriate sequence/structure modifications or, better yet, the development of a general strategy for the design of a new class of peptides with similar activity but with no toxicity.
In this article, we introduce a general strategy in which two different peptide segments, instead of two identical ones, were combined. Again, these peptide segments were selected from the proteins belonging to the plant’s innate immune repertoire (; ; ). The goal was to demonstrate that the combination of two different peptides results in a chimera suitable for the treatment of bacterial diseases in plants. In addition, we wanted to show that these chimeras not only show bactericidal activity on infected plants but also augment a plant’s innate immune system during infection. These chimeric peptides were constructed by joining two different segments from citrus/apple proteins. These segments in isolation show (or are predicted to show) the membranolytic/killing activity of Gram-negative bacteria. Typically, the individual segments show low bactericidal activity; however, when present in a chimera scaffold, high activity is observed due to their synergy. These segments are generally unstructured in isolation but can form α/β structures when they encounter hydrophobic solvents akin to the bacterial membrane (). However, the α/β chimera scaffold may facilitate the formation of alpha or beta structures even without the association of a bacterial membrane. The following steps led to the identification of non-toxic α/β-peptide chimeras that clear bacteria and augment the innate immunity during infection. Firstly, we performed molecular modeling to construct a library of peptide chimeras by joining two antibacterial α/β segments from citrus/apple proteins and selected energetically stable ones with high predicted activity. Secondly, we custom synthesized the selected chimeras and measured the minimum inhibitory concentration (MIC) against Gram-negative Escherichia coli. Thirdly, we determined the toxicity of the chimeras that showed high activity on plant and human cells. Fourthly, the chimeras that were non-toxic and had high activity were examined in an ex planta detached leaf assay for anti-CLas and anti-amylovora activity. Finally, we determined the expression of selected genes to show that the chimeric peptides augmented the innate immunity in citrus/apple during infection.
Results
Identification of chimeric peptides with in vitro bactericidal activities on E. coli
Antibacterial peptides, which are present in many plant proteins, can either be linear or disulfide (S–S) bridged (). The linear peptides were the main focus of the current study. As shown in Table 1, four types of linear antibacterial peptides were considered (): i) amphipathic peptides such as KKLIKKILKIL/KKLFKKILKYL, designated as unit A; ii) FWQ-containing basic peptides, such as FWQRRIRRWRR/FQWQRNIRKVR, designated as unit C/B; iii) R/W-rich peptides, such as RRWWRWWR, designated as unit D; and iv) IERSTNLDWYKGPTLL or unit E identified from plant extracts (). A library of chimeras was constructed by joining two different units with a linker containing one to eight amino acids. The initial structure of each chimera was obtained using homology modeling (Waterhouse et al., 2018) and energy minimized in a vacuum using the GROMOS96 (CHARMM: the biomolecular simulation program 2009) force field (). Previously, we have performed molecular dynamics (MD) simulation of various peptides in a water/(lipid bilayer) system to visualize the three determinants of the antibacterial activity of helical amphipathic peptides (; ), namely, membrane attachment, insertion, and rupture. The MD simulations also revealed that the antibacterial activity depended on the helical content and stability of the chimera, the total charge, and the relative disposition of the charged vs. hydrophobic amino acids on the surface or in the interior of the structure. These parameters in the energy-minimized structures of the chimeras allowed their empirical ranking in terms of antibacterial activity. The top-ranked chimeric peptides were custom synthesized in milligram quantities. We then measured the MICs of the peptides that killed all 5 × 105 colony-forming units (cfu) of a bacterial culture after 24 h of incubation (Wiegand et al., 2008). The MIC assay was performed on a 96-well plate by serial dilution of the peptide in the concentration range 0.02–20 μM. The growth of the E. coli strain BL21 (and, in some cases, ATCC25922) was monitored by measuring the optical density (OD)/cfu. This produced the range of MICs, above which no bacterial growth was observed. Table 1 shows the MIC ranges of the individual units A–E and the chimeras constructed by joining two of them. The chimeric peptides with MICs above 20 μM were not further studied. Supplementary Tables SIA, SIB show various fragments of the citrus and apple proteins that are homologous to the various chimeras shown in Table 1, which shows segments homologous to: i) single units on the N/C-terminal of the chimeras; ii) linkers joining them; and iii) the chimera fragments containing the N-terminal, the linker, and the C-terminal.
Table 1
| Code | Type of scaffold | Amino acid sequence | MIC (mM) |
|---|---|---|---|
| 11P-1 | Unit A | KKLIKKILKIL (KKLFKKILKYL)a | 10–20 |
| 11P-2 | Unit B | FQWQRNIRKVRb | >20 |
| 11P-3 | Unit C | FWQRRIRRWRR | >20 |
| 8P-1 | Unit D | RRWWRWWR | >20 |
| 16P-1 | Unit E | IERSTNLDWYKGPTLL | >20 |
| Gen-1 | Chimera AA-1 | KKLPKEILKILGSGYGSLPKEILKILELKK | 5-10 |
| Gen-2 | Chimera AC-7 | KKLPEKILEILGSGYKKLPFWQRRIRRWRR | 2.5–5 |
| 30P-1 | Chimera AC-1 | KKLIKKILKILGSGYGSPGFWQRRIRRWRR | 1.25–2.5 |
| 30P-2 | Chimera CA-1 | FWQRRIRRWRRGSGYGSPGKKLIKKILKIL | 1.25–2.5 |
| 30P-3 | Chimera AC-2 | KKLPKKILKILGSGYGSPGFWQRRIRRWRR | 0.6–1.25 |
| 27P-1 | Chimera DC-1 | RRWWRWWRGSGYGSPGFWQRRIRRWRR | >20 |
| 27P-2 | Chimera CD-1 | FWQRRIRRWRRGSGYGSPGRRWWRWWR | 5–10 |
| 27P-3 | Chimera AC-3 | RKPARKVLKILGRGSEFWQKRVRRWRR | 10–20 |
| UGK-1 | Chimera CD-2 | RLPKAFQWQRRLRRWRRPYSPGRRWWRWWR | 5–10 |
| UGK-5 | Chimera CD-3 | RLPEAFQWQRRLRRWRRPDSPGRRWWRWWR | 5–10 |
| UGK-9 | Chimera CD-4 | RLPEAFQWQRNIRKVRRPDSPGRRWWRWWR | 5-10 |
| UGK-13 | Chimera AC-3 | KKLPEKILKILESGYGSPGFWQRRIRRWRR | 0.625–1.25 |
| UGK-17 | Chimera AC-4 | KKLPEKILKILESLKGSPGFWQRRIRRWRR | 1.25–2.5 |
| UGK-21 | Chimera AC-5 | KKLPQKLLEILKSLKGSPGFWQRRIRRWRR | 1.25–2.5 |
| UGK-25 | Chimera AC-6 | KKLPEKLLEILKSLEGSPGFWQRRIRRWRR | 2.5–5 |
| UGK-29 | Chimera AD-1 | KPRGSEQLQELTRRLLDSPLERRWWEWMRR | >20 |
| UGK-33 | Chimera AD-2 | KPRLSEQLQELTRRLLDSPLERRWWEWWRR | >20 |
| UGK-37 | Chimera AD-3 | KPRGSEQLQELTRRLLDSPLERRFWQWMRR | >20 |
| UGK-41 | Chimera AD-4c | KRPEELLQKLKSLEGSKAHLQHHDWTSK | >20 |
| UGK-45 | Chimera AD-5c | LPKRLEELLQKLKSLEGSKAHEKLHDWTRK | >20 |
| UGK-49 | Chimera AD-6c | QPKRLEELLEKLKSLEGSKAHEKLHDWTRK | >20 |
| UGI-7 | Chimera DC-2 | RRWWRWWRGSYGSVYGSPGFWQRRIRRWRR | 5–10 |
| I27AB | Chimera E+1 | IERSRNLDWYKGPTLLDALKNLNEGKR | >20 |
| I31LB | Chimera E+2 | IERSRNLDWYKGPTLLDALKNLNEGKRPSDK | >20 |
| L19GA | S–S bridged#2 | KC2RRLC6YKQRC11VTYC15RGRQd | 1.25–2.5 |
Minimum inhibitory concentrations (MICs, in micromolars) of the single-unit antibacterial peptides and the chimeras constructed with the single antibacterial units.
Homolog of A: a hybrid of cecropin and melittin.
Very similar to C: intrachain disulfide (S–S) bridges C2–C15 and C6–C11.
Distant homologs of AD.
S–S bridged.
The chimeric peptides with MICs in the range 0.6–2.5 μM were considered potential bactericidal agents and were selected for the bioluminescence assay for determining the exact MIC values. The bioluminescence assay () helps measure the number of viable bacterial cells in a culture based on the quantitation of the ATP present. It should be noted that ATP is present in live (metabolically active) cells, but not in dead cells. Table 2 lists the bactericidal activities of the promising antibacterial chimeras on E. coli BL21. Bactericidal activity was expressed in terms of IC50 and IC99–MIC. Table 2 also includes the IC50 and IC99–MIC of the single units A–E and those of the equimolar mixtures of A (11P-1) and C (11P-3). Chimeras AC and CD were the most promising antibacterial agents. The synergistic effects of units A and C in chimeras should also be noted, as evidenced by the much lower MICs of these chimeras compared to those of the individual A/C units, or the equimolar mixtures of units A and C (see Supplementary Figure S2 for additional explanations). Figure 1A shows the cfu per milliliter values from the bioluminescence assay at different peptide concentrations, which reveals the slope of the transition from live to dead bacteria upon peptide binding to bacteria, and Hill’s coefficient, an index of cooperative binding (). We also measured bacterial cell lysis by the different peptides using the NanoLuc luciferase assay. For this assay, E. coli BL21 (pACYC184-nLuc) was treated with 10 µM peptides and the luciferase activity was monitored in the supernatant at 15 min and at 1 h post-treatment. Peptide concentrations (higher than the MICs) were needed to observe the early effect on E. coli. The measured luciferase activity is proportional to the number of lysed bacterial cells. Figure 1B shows the percentage of bacterial lysis by the single units (11P-1 and 11P-3) and their α/β chimeras (30P-3, UGK-13, and UGK-17). It appears from the data shown in Figures 1A, B that UGK-17 was the most active chimera on E. coli. The synergy of the antibacterial activities of 11P-1 and 11P-3 in the chimera 30P-3 is illustrated in Supplementary Figure S1, i.e., the activity of the chimera was higher than the additive effects of 11P-1 and 11P-3 (in fact, there was a negative interference of the two when added together in equimolar concentrations).
Table 2
| Peptide | IC50 (µM) | IC99 (µM) (~MIC) | Hill’s coefficient |
|---|---|---|---|
| UGK-13/chimera AC-3 | 1.24 ± 0.02 | 1.40 ± 0.03 | 36 |
| UGK-17/chimera AC-4 | 1.36 ± 0.04 | 1.97 ± 0.06 | 12 |
| 30P-3/chimera AC-2 | 1.45 ± 0.09 | 2.41 ± 0.11 | 9 |
| Gen-1/chimera AA-1 | 10.22 ± 0.07 | 11.4 ± 0.07 | 41 |
| Gen-2/chimera AC-7 | 2.83 ± 0.14 | 4.48 ± 0.22 | 10 |
| UGK-19GA/S–S bridged#2 | 1.49 ± 0.22 | 1.88 ± 0.29 | 20 |
| 11P-1/unit A | 12.94 ± 0.62 | 29.38 ± 0.75 | 6 |
| 11P-3/unit C | 48.98 ± 2.79 | 160.80 ± 3.25 | 4 |
| 11P-1+11P-3/unit A + unit C | 40.97 ± 1.11 | 60.00 ± 1.63 | 12 |
Bactericidal activity of the selected α/β peptides measured using the bioluminescence assay.
The IC50 and IC99 (which are the MICs) and Hill’s coefficients were calculated from the dose–response (bioluminescence vs. peptide concentration) sigmoidal curve.
Figure 1
The ratio of live/dead E. coli BL21 cells due to peptide treatment was also monitored using a fluorescent-based assay (). For this assay, two fluorescent dyes, SYTO9 and propidium iodide (PI), were used. SYTO9 stains green in both live and dead cells, whereas PI only intercalates and stains red the DNA of the dead cells or the cells with ruptured membranes. Figure 2A shows the percentage of live cells after 1 h of 20 μM peptide treatment on 5 × 105 cfu of E. coli BL21 relative to the live and dead cell controls, whereas Figure 2B shows the same data presented visually by fluorescent images of green- and red-labeled BL21 upon peptide treatment. Peptide concentrations (higher than the MICs) were needed to observe finite changes in fluorescence in treated and untreated E. coli. The single units (11P-1 and 11P-3) and their α/β chimeras (30P-3, UGK-13, and UGK-17) are shown in Figures 2A, B. In addition, the effect of L19GA on E. coli BL21 is shown in Figures 2A, B. It should be noted that the L19GA peptide contains two β-strands with two intrachain disulfide bridges. Finally, we performed single-color fluorescent microscopy. For this, the peptides were incubated for 1 h with E. coli BL21 (pACYC184-GFP). Figure 2C shows the fluorescent micrographs after 1 h of peptide treatment. The peptide that shows the highest clearance or the lowest reduction in green fluorescence is the most active on E. coli. Thus, the single- and two-color fluorescent assays showed that UGK-17 was the most active peptide on E. coli.
Figure 2
Plant and human cell toxicity of the peptide chimeras with in vitro bactericidal activity on E. coli
Both plant and human toxicity analyses were performed on the chimeras UGK-13, UGK-17, UGK-9, and 30P-3. Plant toxicity was measured by infiltrating 1 ml of 15–25 μM peptide solution to each tomato and tobacco leaf using a 1-ml syringe (). The peptide concentrations were 10 times or higher than their MICs on E. coli. Each leaf was abaxially and adaxially infiltrated at four to six spots. The infiltrated plants were kept for 96 h in a growth chamber. The infiltrated leaves were visually analyzed at 24, 48, 72, and 96 h. When a peptide is toxic at a given concentration, the corrosive effect spreads in the leaf beyond the infiltration spots. Table 3 summarizes the leaf infiltration data, which show that the chimeras (UGK-13, UGK-17, UGK-9, and 30P-3) were not toxic to tomato and tobacco at concentrations of 15–25 μM even after 96 h of leaf infiltration. Figures 3A, B show the tomato and tobacco leaves after 24 and 96 h of 15–25 μM peptide infiltration using UGK-13, UGK-17, and 30P-3 relative to the water-infiltrated control. Supplementary Figure S2 displays the data on all four peptides (UGK-13, UGK-17, UGK-9, and 30P-3) for all 24, 48, 72, and 96 h of infiltration. Similar to the control, the peptide-infiltrated tomato and tobacco leaves showed no corrosion beyond the infiltrated spots.
Table 3
| Peptides | Control | Dose 1 (mM) | Dose 2 (mM) | Dose 3 (mM) | Volume infiltrated (ml) | Toxicity (monitored up to 96 h) |
|---|---|---|---|---|---|---|
| UGK-13 | Water | 15 | 20 | 25 | 20 | Not toxic |
| UGK-17 | Water | 15 | 20 | 25 | 20 | Not toxic |
| 30P-3 | Water | 15 | 20 | 25 | 20 | Not toxic |
| UGK-9 | Water | 15 | 20 | 25 | 20 | Not toxic |
Toxicity of the selected chimeras on tobacco and tomato leaves by infiltration of 15–25 mM peptide solution and the corrosive effect beyond the infiltration spots after 24–96 h.
Water was used as the non-toxic control.
Figure 3
The toxicity of the chimeric peptides was also measured on human cells using human erythrocytes and human embryonic kidney (HEK) cells. Hemoglobin release via hemolysis or membrane rupture of erythrocytes provides a rapid measure of toxicity of the chimeric peptides (). Figure 4A shows the percentage of hemolysis of human erythrocytes by UGK-13, UGK-17, and 30P-3 at 20 μM relative to phosphate-buffered saline (PBS; negative control) and 0.01% Triton X-100 (positive control). The cytotoxicity of the HEK cells due to the three chimeric peptides was measured with the MTT [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] assay (), which assessed the metabolic activity of live cells by monitoring the level of intracellular NAD(P)H-dependent oxidoreductase enzymes. Figure 4B shows the percentage of cytotoxicity of the HEK cells treated with 20 μM UGK-13, UGK-17, and 30P-3 relative to PBS and Triton-X. The three chimeras at 20 μM concentration (10 times higher than their MICs) showed low (<20%) toxicity to human erythrocytes and HEK cells.
Figure 4
Structural models of the chimeras with bactericidal activity and low toxicity
Molecular models of the four chimeras (30P-3, UGK-13, UGK-17, and UGK-9) are shown in Figures 5A–D. As abovementioned, the models were energy minimized after obtaining the initial homology-based structures. It should be noted that 30P-3, UGK-13, and UGK-17 belong to the AC chimera family, whereas UGK-9 belongs to the CD chimera family (Table 1). The three AC chimeras contain α-helical units of A and C. In all three AC chimeras, the fourth residue “I” in unit A was replaced by “P” to better nucleate the N-terminal α-helix. The linkers are different in the three AC chimeras in terms of sequence and length. The linkers also adopt different conformations, judging by the peptide backbone angles (ϕ and ψ) in the energy-minimized models. The linker in 30P-3 (GSGYGSPG) adopts an extended (or β) conformation, whereas the linker in UGK-13 (GYG) forms a sharp GY turn followed by a short β-strand connecting the C-terminal helix. Finally, the single amino acid S linker in UGK-17 forms a β-strand (or a kink) between the N- and C-terminal helices. UGK-9, a member of the CD chimera family, forms three α-helices. The N-terminal helix is connected by a single amino acid β-stranded “F” to the central helix, which is connected to the C-terminal helix by an SPGR turn. In the CD chimera UGK-9, a segment of RLPEA is added to unit C to extend the N-terminal α-helix. L19GA is a single peptide fragment with antibacterial activity on E. coli BL21 (see Table 1) with homologs in citrus and apple (see Supplementary Tables SIA, SIB). Two β-strands are joined by a YKQR turn. Thus, in the study, we considered peptides with α-helices and β-strands (designated as α/β peptides). The individual α-helix or β-strand may contribute to the antibacterial activity. In addition, a β-strand may also define the conformation of a linker in the chimera. One important feature of the α/β peptides is the relative dispositions of the basic, acidic, and hydrophobic amino acids, which are important for the stability and activity of the peptides (see Supplementary Figure S3 for further details).
Figure 5
Ex planta antibacterial activities of selected chimeric peptides against CLas and E. amylovora
After determining the antibacterial activities of 30P-3, UGK-13, UGK-17, and UGK-9 and their lack of toxicity to plant leaves and human cells, we examined whether these chimeras clear the causative bacteria from infected citrus and apple leaves collected from the field. We collected the citrus grapefruit leaves with HLB from Texas and the Red Delicious apples with fire blight from New Mexico. Ex planta bactericidal assays are particularly relevant since CLas cannot be cultured in the laboratory. The ex planta assay allowed comparison of the clearance of CLas and E. amylovora by various chimeras under the same condition. The ex planta assay involved the collection of infected citrus and apple leaves and the measurement of the bacterial load by quantitative PCR (qPCR) in peptide-treated and untreated leaves. Specifically, the infected leaves (pretested with or without symptoms) were collected from the field. The petioles of the leaves were dipped into sealed Eppendorf tubes containing 1–2 ml of 20–25 μM peptide solution or water (untreated control). It was estimated that the absorption of 0.8–1 ml of peptide solution was needed for complete clearance. It took about a day for the apple leaves while it took up to 3 days for the citrus leaves to absorb 0.8–1 ml of peptide solution. The treated and untreated leaves were then crushed and the total DNA/RNA was extracted. The bacterial load was measured from the extracted DNA/RNA using qPCR with primers specific to the 16S RNA locus in CLas () and a DNA locus in the plasmid pEA29 in E. amylovora (). It should be noted that both live and dead bacterial loads are measured by qPCR of DNA, whereas only the live bacteria are counted by qPCR of RNA. Moreover, primers specific to citrus and apple reference genes were used to ensure that the amplification of these genes was unaltered by treatment, thereby confirming that the peptides were specific to the bacteria. The cytochrome oxidase (COX) of citrus and the ubiquitin of apple were chosen as the reference genes for the qPCR of DNA, while the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) gene in citrus and apple was selected as the reference gene for the qPCR of RNA. Table 4 shows the effect of 25 μM 30P-3, UGK-9, UGK-13, and UGK-17 on the Ct values and the cfu of CLas and E. amylovora by DNA and RNA qPCR. Typically, treatment showing an increase in the Ct value over 5 and a decrease in cfu ~100 is considered effective (). Figure 6 shows the percentage of bacterial clearance by the four chimeras relative to the untreated control. UGK-17 was the most effective on CLas both by DNA and RNA qPCR. From the DNA qPCR, all four chimeras (30P-3, UGK-9, UGK-13, and UGK-17) appeared to be equally effective on E. amylovora. However, the RNA qPCR clearly revealed the higher effectiveness of UGK-13 and UGK-17 compared to UGK-9 and 30P-3. We relied more on the qPCR of RNA to differentiate the effectiveness of the peptides to clear bacteria. Supplementary Tables SIIIA, SIIIB show the qPCR data for both peptide concentrations 20 and 25 μM. In summary, our data indicated that UGK-17 and UGK-13 were effective in clearing E. amylovora, whereas UGK-17 was effective in clearing CLas.
Table 4
| Treatment | DNA | RNA |
|---|---|---|
| CLas clearance from infected citrus leaves | ||
| Water (control) | 23.99 ± 0.020 (9.4 × 105 ± 0.051) | 26.04 ± 0.020 (7.4 × 105 ± 0.071) |
| UGK-17 | 31.44 ± 0.013 (9.2 × 103 ± 0.210) | 33.30 ± 0.026 (7.0 × 102 ± 0.310) |
| UGK-9 | 23.07 ± 0.009 (10.3 × 105 ± 019) | 24.56 ± 0.019 (8.8 × 105 ± 0.053) |
| UGK-13 | 28.05 ± 0.012 (5.5 × 104 ± 0.065) | 31.12 ± 0.011 (7.7 × 103 ± 0.065) |
| 30P-3 | 29.08 ± 0.018 (2.3 × 104 ± 0.122) | 31.80 ± 0.028 (6.8 × 103 ± 0.190) |
| Erwinia amylovora clearance from infected apple leaves | ||
| Water (control) | 28.73 ± 0.590 (5.6 × 104 ± 0.07) | 28.91 ± 0.990 (5.4 × 104 ± 0.051) |
| UGK-17 | 34.46 ± 0.028 (400 ± 0.31) | 34.10 ± 0.560 (700 ± 0.210) |
| UGK-9 | 35.66 ± 1.43 (~102) | 32.62 ± 0.570 (4.7 × 103 ± 0.019) |
| UGK-13 | 35.78 ± 2.98 (~102) | 34.44 ± 0.620 (300 ± 0.065) |
| 30P-3 | 36.50 ± 0.89 (~102) | 31.54 ± 0.018 (7.8 × 103 ± 0.122) |
Data from the detached leaf assay on infected citrus (grapefruit) and apple (Red Delicious) leaves measuring the effect of a 0.8-1ml peptide solution at 25 μM concentration.
The levels of bacteria in the DNA/RNA extracted from the infected leaves were measured using qPCR, which provided the Ct values for the amplicon generated by the CLas- and E. amylovora-specific primers. The colony-forming units (cfu) of the bacterial load were computed using the cfu vs. Ct standard curve (; ).
CLas, Candidatus Liberibacter asiaticus.
Figure 6
Host-derived chimeric peptides augment plant innate immunity
A plant’s innate immunity during bacterial infection mainly involves the induction and coordination of pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) and salicylic acid/jasmonic acid/ethanol (SA/JA/ET) signaling (). PTI is induced by bacterial PAMP, leading to the activation of transcription factors via the mitogen-activated protein kinase (MAPK)/MAPK kinase (MAPKK)/MAPK kinase kinase (MAPKKK) signalosome cascade and, finally, the induction of the PR proteins. However, PTI may be inhibited by the bacterial effectors, which, however, may be countered by effector-triggered immunity (ETI) through the binding of the bacterial effectors to the intracellular Nod-like receptor (NLR) resistance protein (Yuan et al., 2021). Effector–NLR binding may rescue PTI signaling by reinforcing the MAPK/MAPKK/MAPKKK signalosome complex, leading to disease resistance. The universal WRKY transcription factors play a key role in both activating or suppressing specific defense genes (). SA/JA/ET signaling is an important component of a plant’s innate immunity against bacterial infections (Zhang et al., 2018; ). The general scheme of this phytohormone signaling involves the activation of inducible transcription factors and the production of PR proteins. Thus, we focused on examining whether the innate immunity in citrus/apple involving PTI, ETI, and SA/JA/ET signaling was augmented during infection by the chimeric peptides. RNA was extracted from both treated and untreated citrus/apple samples from the detached leaf assay described above. Subsequently, differential expression of the selected genes in PTI, ETI, and SA/JA/ET signaling was analyzed using qPCR. It has been proposed that the host antimicrobial peptides may possess the intrinsic ability to directly activate MAPK/MAPKK/MAPKKK and, therefore, the production of the PR proteins (). We did not test this hypothesis in this study by measuring the gene expression in healthy (bacteria-free) citrus or apple leaves upon treatment of the chimeric peptides.
Figure 7A shows the heatmap of the fold changes on a Log2 scale of the selected genes from treatment with 25 μM UGK-17 and UGK-13 on infected grapefruit leaves at 3 days posttreatment and absorption of 0.8–1 ml of the peptide solution. The fold changes were normalized relative to the expression of the housekeeping gene, GAPDH. UGK-17 at 25 μM cleared CLas to almost 100%, whereas UGK-13 at the same concentration cleared over 80%. The selected genes belong to pattern recognition receptors or PRR (FRK1), singling proteins (MAPK6, MAPKK3, CoL1, LEA5, and EMB564), transcription factors (WRKY4/22/24/29, ERF003/6, and zinc fingers), and PR proteins (PR1/2/3, defensin Ec-AMP-D61, chitinase1, and LTP2). The selected list also included detoxifying enzymes such as CYPP450 82G1 and GST1, the glycosidases CsSB1 and CsSD1, and the lipase GDSL, which may be expressed as a defense response. The phloem-specific PP2 protein, a marker for CLas infection, was overexpressed. Most of the selected genes were overexpressed (with two-three fold changes) by peptide treatment, most notably the PR proteins, which are the end products of PTI, ETI, and SA/JA/ET signaling.
Figure 7
Figure 7B shows the heatmap of the fold changes on a Log2 scale of the selected genes from treatment with 25 μM UGK-17, UGK-13, and 30P-3 on infected Red Delicious apple leaves at 48 h posttreatment and absorption of 0.8–1 ml of the peptide solution. The selected genes contained plasma membrane and intracellular receptors, genes such as LHC and Jaz17; gibberellin (GA)-stimulated genes involved in cytosolic signaling; transcription factors including JA-induced bHLH, ERF, and AP2/ERF; and, most importantly, the PR genes [ribonuclease, defensin, chitinase, and the detoxifying enzymes peroxidase and succinate dehydrogenase (SDH)]. In addition, the genes for XTH (xyloglucan endotransglucosylase/hydrolase) and the hydroxyproline-rich protein involved in membrane structure and biogenesis were included. The selected genes have been shown to be important components of the apple reactome (). Treatment with the three chimeras showed distinctly different patterns in terms of gene expression. A lot more genes were overexpressed by UGK-17 than by the UGK-13 chimera, although both showed similar bactericidal activities (see Figures 5C, D). Moreover, 30P-3, which showed lower activity by RNA qPCR, also showed lower expression of the selected genes.
Discussion
In this paper, we reported the design of the α/β peptides, which are chimeras formed by two different segments. We have previously reported on the design of protein chimeras in which two 5- to 25-kDa host protein domains (instead of the <5-kDa peptides described here) were joined by a linker (; ). The two host protein domains represented lysis and recognition of the infecting bacteria. Transgenic grape expressing these chimeras showed resistance against PD in the greenhouse and field studies. The combination of molecular modeling and bactericidal/toxicity analyses showed that the chimeric peptides UGK-13 and UGK-17 were the two promising non-toxic candidates in that both of them cleared E. amylovora from apple leaves infected with fire blight, whereas UGK-17 cleared CLas from citrus infected with HLB. The qPCR also showed that both UGK-13 and UGK-17 augmented the innate immunity in citrus and apple during infection. The bactericidal peptide segments (designated here as single units) in the host proteins were discovered almost three decades ago (). They have been shown to be active against antibiotic-resistant planktonic and biofilm bacteria. In addition, they were expected to exert immune stimulatory activity (Moghaddam et al., 2015). However, it was soon discovered that the bacteria quickly evolved resistance against the host peptide by modifying their membrane structure (; ). As described herein and in [14], our approach of combining two antibacterial peptide segments helped overcome bacterial resistance while retaining bactericidal effects. Finally, the designed chimeras are not toxic to humans and plants and are stimulatory to the host’s innate immune system.
Figure 8 summarizes the results of our study and the possible scope of α/β chimeric peptides in the treatment of bacterial diseases in plants. The innate immune response is induced in plants during bacterial infection, which, as described above, involves the PTI/ETI and plant hormone SA/JA/ET pathways, leading to the production of PR proteins. The end result is bacterial clearance and/or blocking of bacterial pathogenesis (shown respectively as broken green lines). However, pathogenic bacteria have evolved multiple strategies () to block the PTI/ETI and plant hormone SA/JA/ET pathways, as well as the resulting production of PR proteins (shown as red lines). We presented a counterstrategy to overcome bacterial resistance by designing host-derived and non-toxic α/β chimeric peptides that lyse the membrane and clear the pathogenic bacteria (shown as solid green lines), as well as augment the PTI/ETI and plant hormone SA/JA/ET pathways (shown as dashed green lines), during bacterial infection. Our strategy can be extended to the design of α/β chimeric peptides against other bacterial diseases in plants with agricultural and economic importance.
Figure 8
Experimental procedures
Phytotoxicity assays in plants
The leaves of different plants were infiltrated with 10 μl of each peptide at different concentrations using a syringe. PBS was used as the negative control. Two independent experiments were performed in which three leaves were inoculated abaxially/adaxially at three different points. The necrotic effects were visually monitored to examine the possible toxicity of the peptide. The leaves were placed in agar plates (1%) for 7 days and maintained under controlled conditions at 26°C and a photoperiod of 16-h light/8-h dark.
Minimal inhibition concentration assay
Bacterial cultures of E. coli BL21 and ATCC 25922 were inoculated into 20 ml Mueller Hinton II broth (MHB, Difco, Franklin Lakes, NJ, USA) and incubated for 16 h at 37°C with shaking. The concentration of the bacterial cells was determined using an OD600 = 1 for 109 cells and was verified by plating corresponding dilutions. Diluted aliquots (105 cells/ml) were sub-cultured in 96-well polystyrene microtiter plates with twofold serial dilutions of the corresponding peptides (20–0.16 µM) and then incubated for 16 h at 37°C without shaking. After the incubation, the ODs of the plates were measured using a plate reader (Synergy HTX; BioTek, Santa Clara, CA, USA). The MIC was defined as the lowest concentration of peptides that produced no visible growth (Wiegand et al., 2008).
Bioluminescence assay
The BacTiter-Glo™ Microbial Cell Viability Assay (Promega G8231, Madison, WI, USA) was used to determine the number of viable microbial cells (or cfu) in the cultures obtained for the determination of MICs. After incubation with peptides and determining the ODs, the bacterial cultures in polystyrene plates were carefully resuspended to homogeneity by shaking in a plate reader incubator for 5 min at 100 rpm. Of the corresponding bacterial cultures, 50 µl was transferred into a black microtiter plate and was mixed with an equal volume of the BacTiter-Glo™ reagent, which resulted in bacterial lysis and generated a bioluminescence signal proportional to the ATP content. To determine the exact cfu values, a standard curve was used to correlate the cfu to bioluminescence. Bioluminescence was measured using a plate reader (Synergy HTX; BioTek). The dose–response curves were obtained for the most active peptides by plotting the cfu values against the peptide concentrations. To determine the inhibitory concentration, IC50% and IC99%, values, the dose–response curves were fitted to Hill’s equation ().
Staining of live/dead cells
To examine the peptide-induced bacterial death, the LIVE/DEAD cell staining kit (L7012; Thermo Fisher, Waltham, MA, USA) was used. An overnight bacterial culture of E. coli BL21 was diluted in fresh 1:10 Luria–Bertani (LB) medium and bacterial growth continued for 2 h at 37°C with aeration at 200 rpm. Of the bacterial culture, 10 ml was precipitated by centrifugation at 5,000 rpm for 15 min. The bacteria were resuspended in 2 ml of 0.15 M NaCl. Three additional washes with 0.15 M NaCl were performed to remove traces of bacterial media. The bacterial concentration was adjusted with PBS to obtain a final concentration of 5 × 106 cells/ml. The bacterial suspension was then mixed with the peptide solution in 0.15 M NaCl and incubated for 1 h at room temperature. Thereafter, the cells were stained with a LIVE/DEAD dye mix. The fluorescence of live cells showed green due to the SYTO™ 9 nucleic acid. The SYTO 9 stain generally labels all bacteria in a population: those with intact membranes and those with damaged membranes. The fluorescence of dead cells showed red since PI penetrates only those bacteria with damaged membranes, causing a reduction in the SYTO 9 fluorescence when both dyes are present. For the live cell control, the cells were incubated with PBS only; for the dead cell control, the cells were killed with 70% isopropanol before staining.
The live/dead cell ratio was measured according to the manufacturer (L7012; Thermo Fisher). The cells were treated with peptides, as described above. At the end of the incubation, the peptide-treated bacterial suspensions were mixed with equal volumes of 2× working solution of the LIVE/DEAD dyes. The samples were then incubated for 15 min at room temperature in the dark. The fluorescence intensity was measured using a plate reader (SpecraMax M4; Molecular Devices, Sunnyvale, CA, USA) in 96-well black microtiter plates (Corning, Corning, NY, USA): emission 1, green: Λex = 485 nm, Λem = 530 nm; emission 2, red: Λex = 485 nm, Λem = 630 nm. The ratio was determined and normalized using the control samples.
Hemolytic assay
To determine the toxicity of the peptides, a hemolytic assay was routinely performed using human erythrocytes obtained as 10% Single Donor Human Red Blood Cells Washed (Innovative Research, Clearwater, FL, USA). The procedure was based on the measurement of hemoglobin release upon erythrocyte lysis. PBS (pH 7.4) was used to suspend the erythrocytes and dilute the peptide samples. Human erythrocytes (red blood cells, RBCs) were washed with PBS and adjusted to a concentration of 1% (v/v). Approximately 100 µl of 1% RBC was then mixed with 100 µl of the peptide samples and the tubes were incubated at 37°C for 60 min. The samples were centrifuged for 5 min at 14,000 × g, the supernatants were collected, and the ODs at 445 and 415 nm corresponding to the Soret bands of the released hemoglobin were determined by NanoDrop. PBS and 0.01% Triton-X-100 were used respectively as the negative (0%) and positive (100%) controls ().
MTT cytotoxicity assay
The MTT assay () was used to determine the cytotoxicity of the compounds by examining the cell metabolic activity, e.g., the activity of NAD(P)H-dependent cellular oxidoreductases is proportional to the number of viable cells present. The cells were seeded at a density of 1 × 104 cells/well in 96-well culture plates and allowed to adhere overnight at 37°C. After 24 h of incubation, HEK 294 cells (Sigma-Aldrich, St. Louis, MO, USA) were treated with 20 µM of peptides and incubated for 72 h. PBS (pH 7.4), the solvent used to make the peptide stock solution, was used as a non-treatment control in this experiment. At 72 h post-stimulation, the cells were treated with 10 μl of 5 mg/ml MTT solution (Sigma-Aldrich) and incubated for an additional 3 h. Triton X-100 (0.1%) was used as 100% control. Formazan crystals were dissolved in 100 μl of lysis solution, and the absorbance was determined at 570 nm using a microplate reader (Synergy HTX; BioTek).
Monitoring of bacterial lysis
To monitor bacterial lysis during the bacterial peptide treatments, we transformed E. coli BL21 with reporter plasmids expressing codon-optimized eGFP and NanoLuc® Luciferase (Promega, Madison, WI, USA) genes under the control of the constitutive Pupp promoter. To monitor bacterial lysis using fluorescent microscopy, BL21 (pACYC184-GFP) cells were incubated with 10 µM of the antibacterial peptides, and microscopy was performed at time points 15, 30, and 60 min and at 4 h. All fluorescence images were taken at 488 nm excitation. The emission filter was 525/50 nM for cytoplasmic GFP. Phase-contrast images were also collected at the same time points. To monitor bacterial lysis in solutions by protein leakage, BL21 (pACYC184 nLuc) cells were washed with PBS (pH 7.4) three times, diluted with PBS to 105 cfu/ml, and then incubated with peptides for 15, 30, and 60 min. After incubation, the intact bacterial cells were precipitated and the luciferase activity of the supernatant was examined using the Nano-Glo® Luciferase Assay Substrate (Promega). The linearity of the assay was assessed using activity measurements of serial dilutions of the completely lysed BL21 (pACYC184 nLuc) bacterial culture. An undiluted bacterial culture was taken as 100%. Data were corrected to the background luciferase activity obtained with the supernatant of untreated cells.
Detached leaf assay
Both uninfected and infected citrus (grapefruit) leaves were obtained from Texas A&M University—Kingsville Citrus Center, Weslaco, TX, while the infected and uninfected apple (Red Delicious) leaves were obtained from Las Cruces, NM (i.e., Burke Apple Orchard). The leaf samples were stored at −80°C in sealed in Ziplock bags. Before the experiment, the Ziplock bags were placed in a box and transferred into a −20°C refrigerator. Before treatment, the leaves were thawed and dipped in 1–2 ml peptide solution at the specified concentration at room temperature for 48–96 h in a biosafety cabinet. The leaves remained dipped until 0.8–1 ml of the peptide solution was absorbed. The leaves were then crushed in liquid nitrogen inside the biosafety cabinet using a mortar and pestle. The crushed leaves were split into two halves: one for DNA and the other for RNA extraction as per the instructions in the E.Z.N.A.® Plant DNA DS Kit (RNeasy plant mini kit). The extracted DNA and RNA were analyzed using qPCR in a BSL-1 laboratory. The forward and reverse primers for the detection of CLas were GTCGAGCGCGTATGCAATACG and CTACCTTTTTCTACGGGATAACGC, which were chosen to amplify the 16S DNA/RNA (). The forward and reverse primers for the detection of E. amylovora were CACTGATGGTGCCGTTG and CGCCAGGATAGTCGCATA, which were chosen to amplify the locus in the pEA29 plasmid ().
Statements
Data availability statement
The original contributions presented in the study are included in the article/Supplementary Material, further inquiries can be directed to the corresponding author.
Author contributions
SB, ES, LN, NS, and MS performed the experiments, analyzed the data, and drafted the manuscript. GG supervised the experiments, drafted the manuscript, and arranged the funding. MK and JP shipped the samples for the experiments to be conducted in New Mexico and assisted in correcting the manuscript. All authors contributed to the article and approved the submitted version.
Funding
This work was supported by a NIFA grant (no. 2020-70029-33199; “Providing practical solutions for HLB treatment and prevention”).
Acknowledgments
The authors are grateful to LuAnne Burke (Burke Apple Orchard, Las Cruces, NM) for supplying the infected apple leaves. The data presented here are contained in the provisional US patent #63/330,173 filed on 04/12/2022 (inventor: Goutam Gupta; title: “Antibacterial chimeric peptides and their methods of therapeutic use”).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fpls.2022.929478/full#supplementary-material
References
1
AliS.GanaiB. A.KamiliA. N.BhatA. A.MirZ. A.BhatJ. A.et al. (2018). Pathogenesis-related proteins and peptides as promising tools for engineering plants with multiple stress tolerance. Microbiol. Res.212-213, 29–37. doi: 10.1016/j.micres.2018.04.008
2
AlvesM. N.Cifuentes-ArenasJ. C.Raiol-JuniorL. L.FerroJ. A.PeñaL. (2021). Early population dynamics of ". Front. Microbiol.12. doi: 10.3389/fmicb.2021.683923
3
BakshiM.OelmüllerR. (2014). WRKY transcription factors: Jack of many trades in plants. Plant Signal Behav.9 (2), e27700. doi: 10.4161/psb.27700
4
BaoM.ZhengZ.SunX.ChenJ.DengX. (2020). Enhancing PCR capacity to detect '. Plant Dis.104 (2), 527–532. doi: 10.1094/PDIS-05-19-0931-RE
5
BoinaD.BloomquistJ. (2015). Chemical control of the Asian citrus psyllid and of huanglongbing disease in citrus. Pest Manage. Sci.71 (6), 808–823. doi: 10.1002/ps.3957
6
ChenJ.WangX.WangS.ChenC.ZhangW.ZhangY. (2021). Ultra-rapid drug susceptibility testing for. Front. Microbiol.12. doi: 10.3389/fmicb.2021.694522
7
CunsoloV.SchicchiR.ChiaramonteM.IngugliaL.ArizzaV.CusimanoM. G.et al. (2020). Identification of new antimicrobial peptides from Mediterranean medical plant. Antibiotics (Basel)9 (11), 747. doi: 10.3390/antibiotics9110747
8
Da GraçaJ.KorstenL. (2004). Citrus huanglongbing: Review, present status and future strategies. Dis. fruits vegetables1, 229–245. doi: 10.1007/1-4020-2606-4_4
9
DandekarA. M.GouranH.IbáñezA. M.UratsuS. L.AgüeroC. B.McFarlandS.et al. (2012). An engineered innate immune defense protects grapevines from pierce disease. Proc. Natl. Acad. Sci. U.S.A.109 (10), 3721–3725. doi: 10.1073/pnas.1116027109
10
DenizotF.LangR. (1986). Rapid colorimetric assay for cell growth and survival. modifications to the tetrazolium dye procedure giving improved sensitivity and reliability. J. Immunol. Methods89 (2), 271–277. doi: 10.1016/0022-1759(86)90368-6
11
GadagkarS. R.CallG. B. (2015). Computational tools for fitting the hill equation to dose-response curves. J. Pharmacol. Toxicol. Methods71, 68–76. doi: 10.1016/j.vascn.2014.08.006
12
GrahamJ.GottwaldT.SetamouM. (2020). Status of huanglongbing (HLB) outbreaks in Florida, California and Texas. Trop. Plant Pathol.45 (3), 265–278. doi: 10.1007/s40858-020-00335-y
13
GuptaG.LLC.I. I. (2021). Compositions and methods for protecting hosts against pathogen infections. New Mexico: Gupta and Innate Immunity LLC, U.S. patent application 16/479,860.
14
GuptaG.StoverE. (2020). Composition and methods for the treatment of huanglongbing (HLB) aka citrus greening.
15
Hong-GellerE.MöllhoffM.ShiflettP. R.GuptaG. (2004). Design of chimeric receptor mimics with different TcRVbeta isoforms. type-specific inhibition of superantigen pathogenesis. J. Biol. Chem.279 (7), 5676–5684. doi: 10.1074/jbc.M309388200
16
HuanY.KongQ.MouH.YiH. (2020). Antimicrobial peptides: Classification, design, application and research progress in multiple fields. Front. Microbiol.11. doi: 10.3389/fmicb.2020.582779
17
HuB.RaoM. J.DengX.PandeyS. S.HendrichC.DingF.et al. (2021). Molecular signatures between citrus and candidatus liberibacter asiaticus. PloS Pathog.17 (12), e1010071. doi: 10.1371/journal.ppat.1010071
18
HuynhL.VelásquezJ.RabaraR.BasuS.NguyenH. B.GuptaG. (2021). Rational design of antimicrobial peptides targeting gram-negative bacteria. Comput. Biol. Chem.92, 107475. doi: 10.1016/j.compbiolchem.2021.107475
19
Inui KishiR. N.Stach-MachadoD.SingulaniJ. L.Dos SantosC. T.Fusco-AlmeidaA. M.CilliE. M.et al. (2018). Evaluation of cytotoxicity features of antimicrobial peptides with potential to control bacterial diseases of citrus. PloS One13 (9), e0203451. doi: 10.1371/journal.pone.0203451
20
JainD.KhuranaJ. P. (2018). Role of pathogenesis-related (PR) proteins in plant defense mechanism. In: SinghA.SinghI. (eds). olecular Aspects of Plant-Pathogen InteractionSingapore: Springer.
21
JohnsonK. B.StockwellV. O. (1998). Management of fire blight: a case study in microbial ecology. Annu. Rev. Phytopathol.36, 227–248. doi: 10.1146/annurev.phyto.36.1.227
22
JonesJ. D.DanglJ. L. (2006). The plant immune system. Nature444 (7117), 323–329. doi: 10.1038/nature05286
23
JooH. S.FuC. I.OttoM. (2016). Bacterial strategies of resistance to antimicrobial peptides. Philos. Trans. R Soc. Lond B Biol. Sci.371 (1695), 20150292. doi: 10.1098/rstb.2015.0292
24
KamberT.BuchmannJ. P.PothierJ. F.SmitsT. H.WickerT.DuffyB. (2016). Fire blight disease reactome: RNA-seq transcriptional profile of apple host plant defense responses to erwinia amylovora pathogen infection. Sci. Rep.6, 21600. doi: 10.1038/srep21600
25
KharadiR. R.SchachterleJ. K.YuanX.CastiblancoL. F.PengJ.SlackS. M.et al. (2021). Genetic dissection of the. Annu. Rev. Phytopathol.59, 191–212. doi: 10.1146/annurev-phyto-020620-095540
26
KumagaiL. B.LeVesqueC. S.BlomquistC. L.MadishettyK.GuoY.WoodsP. W.et al. (2013). First report of candidatus liberibacter asiaticus associated with citrus huanglongbing in California. Plant Dis.97 (2), 283. doi: 10.1094/PDIS-09-12-0845-PDN
27
KunkelM.VuyisichM.GnanakaranG.BrueningG. E.DandekarA. M.CiveroloE.et al. (2007). Rapid clearance of bacteria and their toxins: development of therapeutic proteins. Crit. Rev. Immunol.27 (3), 233–245. doi: 10.1615/critrevimmunol.v27.i3.40
28
KuntaM.SetamouM.SkariaM.RascoeJ. E.LiW.NakhlaM. K.et al. (2012). First report of citrus huanglongbing in Texas. Phytopathology102, S4.66. doi: 10.1094/PHYTO-102-7-S4.1
29
LehnertN. M.AllenD. L.AllenB. L.CatastiP.ShiflettP. R.ChenM.et al. (2001). Structure-based design of a bispecific receptor mimic that inhibits T cell responses to a superantigen. Biochemistry40 (14), 4222–4228. doi: 10.1021/bi002172e
30
LiN.HanX.FengD.YuanD.HuangL. J. (2019). Signaling crosstalk between salicylic acid and Ethylene/Jasmonate in plant defense: Do we understand what they are whispering? Int. J. Mol. Sci.20 (3), 671. doi: 10.3390/ijms20030671
31
LiJ.HuS.JianW.XieC.YangX. (2021). Plant antimicrobial peptides: structures, functions, and applications. Bot. Stud.62 (1), 5. doi: 10.1186/s40529-021-00312-x
32
MaW.PangZ.HuangX.XuJ.PandeyS. S.LiJ.et al. (2022). Citrus huanglongbing is a pathogen-triggered immune disease that can be mitigated with antioxidants and gibberellin. Nat. Commun.13 (1), 529. doi: 10.1038/s41467-022-28189-9
33
Maria-NetoS.de AlmeidaK. C.MacedaM. L.FrancoO. L. (2015). Understanding bacterial resistance to antimicrobial peptides: From the surface to deep inside. Biochim Biophys Acta. 1848 (11 Pt B), 3078–88. doi: 10.1016/j.bbamem.2015.02.017
34
MonzoC.StanslyP. A. (2017). Economic injury levels for Asian citrus psyllid control in process oranges from mature trees with high incidence of huanglongbing. PloS One12 (4), e0175333. doi: 10.1371/journal.pone.0175333
35
NishadR.AhmedT.RahmanV. J.KareemA. (2020). Modulation of plant defense system in response to microbial interactions. Front. Microbiol.11. doi: 10.3389/fmicb.2020.01298
36
PacielloL.FalcoF. C.LandiC.ParascandolaP. (2013). Strengths and weaknesses in the determination of saccharomyces cerevisiae cell viability by ATP-based bioluminescence assay. Enzyme Microb. Technol.52 (3), 157–162. doi: 10.1016/j.enzmictec.2012.12.011
37
QureshiJ. A.KostykB. C.StanslyP. A. (2014). Insecticidal suppression of Asian citrus psyllid diaphorina citri (Hemiptera: Liviidae) vector of huanglongbing pathogens. PloS One9 (12), e112331. doi: 10.1371/journal.pone.0112331
38
SalmH.GeiderK. (2004). Real-time PCR for detection and quantification of Erwinia amylovora, the causal agent of fireblight. Plant Pathology53, 602–610. doi: 10.1111/j.1365-3059.2004.01066.x
39
SantanderR. D.MeredithC. L.AćimovićS. G. (2019). Development of a viability digital PCR protocol for the selective detection and quantification of live erwinia amylovora cells in cankers. Sci. Rep.9 (1), 11530. doi: 10.1038/s41598-019-47976-x
40
SétamouM.AlabiO. J.KuntaM.DaleJ.da GraçaJ. V. (2020). Distribution of. Plant Dis.104 (4), 1118–1126. doi: 10.1094/PDIS-08-19-1779-RE
41
SharmaG. V.ThodupunuriP.SirishaK.BashaS. J.Gurava ReddyP.SarmaA. V. (2014). Design and synthesis of peptides with hybrid helix-turn-helix (HTH) motif and their conformational study. J. Org Chem.79 (18), 8614–8628. doi: 10.1021/jo501267k
42
SinevaE. V.Andreeva-KovalevskayaZ. I.ShadrinA. M.GerasimovY. L.TernovskyV. I.TeplovaV. V.et al. (2009). Expression of bacillus cereus hemolysin II in bacillus subtilis renders the bacteria pathogenic for the crustacean daphnia magna. FEMS Microbiol. Lett.299 (1), 110–119. doi: 10.1111/j.1574-6968.2009.01742.x
43
SingermanA.RogersM.E (2020). The economic challenges of dealing with citrus greening: The case of Florida. J. Integrated Pest Manage.11 (1), 3. doi: 10.1093/jipm/pmz037
44
TanseyJ. A.VanaclochaP.MonzoC.JonesM.StanslyP. A. (2017). Costs and benefits of insecticide and foliar nutrient applications to huanglongbing-infected citrus trees. Pest Manag Sci.73 (5), 904–916. doi: 10.1002/ps.4362
45
van GunsterenW. F.BakowiesD.BaronR.ChandrasekharI.ChristenM.DauraX.et al. (2006). Biomolecular modeling: Goals, problems, perspectives. Angew Chem. Int. Ed Engl.45 (25), 4064–4092. doi: 10.1002/anie.200502655
46
VuyisichM.GnanakaranS.LovchikJ. A.LyonsC. R.GuptaG. (2008). A dual-purpose protein ligand for effective therapy and sensitive diagnosis of anthrax. Protein J.27 (5), 292–302. doi: 10.1007/s10930-008-9137-0
47
WaterhouseA.BertoniM.BienertS.StuderG.TaurielloG.GumiennyR.et al. (2018). SWISS-MODEL: homology modelling of protein structures and complexes. Nucleic Acids Res.46 (W1), W296–W303. doi: 10.1093/nar/gky427
48
WiegandI.HilpertK.HancockR. E. (2008). Agar and broth dilution methods to determine the minimal inhibitory concentration (MIC) of antimicrobial substances. Nat. Protoc.3 (2), 163–175. doi: 10.1038/nprot.2007.521
49
YuanM.NgouB. P. M.DingP.XinX. F. (2021). PTI-ETI crosstalk: an integrative view of plant immunity. Curr. Opin. Plant Biol.62, 102030. doi: 10.1016/j.pbi.2021.102030
50
ZhangW.ZhaoF.JiangL.ChenC.WuL.LiuZ. (2018). Different pathogen defense strategies in. Cells7 (12), 252. doi: 10.3390/cells7120252
Summary
Keywords
plant pathogen, plant bacteria, plant–pathogen interaction, HLB (citrus greening), fire blight (Erwinia amylovora)
Citation
Basu S, Sineva E, Nguyen L, Sikdar N, Park JW, Sinev M, Kunta M and Gupta G (2022) Host-derived chimeric peptides clear the causative bacteria and augment host innate immunity during infection: A case study of HLB in citrus and fire blight in apple. Front. Plant Sci. 13:929478. doi: 10.3389/fpls.2022.929478
Received
26 April 2022
Accepted
07 December 2022
Published
23 December 2022
Volume
13 - 2022
Edited by
Artemio Mendoza-Mendoza, Lincoln University, New Zealand
Reviewed by
Roel Rabara, Altria, United States; Sheo Shankar Pandey, University of Florida, United States
Updates
Copyright
© 2022 Basu, Sineva, Nguyen, Sikdar, Park, Sinev, Kunta and Gupta.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Goutam Gupta, ggupta@newmexicoconsortium.org
This article was submitted to Plant Pathogen Interactions, a section of the journal Frontiers in Plant Science
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.