Abstract
In the human experience SCARs (suppressor of cAMP receptors) are permanent reminders of past events, not always based on bad decisions, but always those in which an interplay of opposing forces leaves behind a clear record in the form of some permanent watery mark. During plant morphogenesis, SCARs are important proteins that reflect an unusual evolutionary outcome, in which the plant kingdom relies heavily on this single class of actin-related protein (ARP) 2/3 complex activator to dictate the time and place of actin filament nucleation. This unusually simple arrangement may serve as a permanent reminder that cell shape control in plants is fundamentally different from that of crawling cells in mammals that use the power of actin polymerization to define and maintain cell shape. In plant cells, actin filaments indirectly affect cell shape by determining the transport properties of organelles and cargo molecules that modulate the mechanical properties of the wall. It is becoming increasingly clear that polarized bundles of actin filaments operate at whole cell spatial scales to organize the cytoplasm and dictate the patterns of long-distance intracellular transport and secretion. The number of actin-binding proteins and actin filament nucleators that are known to participate in the process of actin network formation are rapidly increasing. In plants, formins and ARP2/3 are two important actin filament nucleators. This review will focus on ARP2/3, and the apparent reliance of most plant species on the SCAR/WAVE (WASP family verprolin homologous) regulatory complex as the sole pathway for ARP2/3 activation.
INTRODUCTION
Actin filaments are polar, unstable polymers composed of G-actin subunits that reversibly associate with one another through non-covalent interactions. Plant cells contain a population of very short-lived individual actin filaments that polymerize rapidly and are rapidly severed and depolymerized (Staiger et al., 2009; Smertenko et al., 2010; Henty et al., 2011). Direct visualization of the actin network using live cell imaging and variable angle epifluorescence microscopy (VAEM; Konopka and Bednarek, 2008) reveals highly dynamic biochemical activities that enable the network to rearrange in response to cellular needs. The functional role of these plasma membrane-associated unstable filaments in slow growing plant cells with growth rates of 1–10%/h is not known. Actin turnover at the plasma membrane may provide the cell with a mechanism to rapidly monitor cortical domains as part of a “pathogen surveillance” mechanism (Staiger et al., 2009) and/or regulate the activity of K+ channels or other integral membrane proteins at the plasma membrane that participate in turgor regulation and growth control (Liu and Luan, 1998). However, these proposed functional roles are pure speculation.
Part of the difficulty in unraveling the complexity of actin-based functions in plant cells is due to the lack of obvious correlations between the presence of actin filament networks and the growth behavior of plant cells. For example, plant cells that employ an intercalary or diffuse growth mechanism grow slowly, with growth rates of a few %/h, and have highly unstable actin networks that rearrange on the time scales of seconds. Furthermore, beyond a general correlation of longitudinal actin bundles in elongated cells, there are no obvious relationships between specific actin structures and changes in cell shape or plasma membrane deformation. This is in contrast to the situation in non-plant systems in which cortical endocytic actin patches (Evangelista et al., 2002; Kaksonen et al., 2003) and the leading edge of crawling cells (Pollard and Borisy, 2003) define subcellular locations where actin does work to locally control membrane dynamics. In thick-walled plants cells, the magnitude of turgor forces that are required to drive cell expansion exceeds, by orders of magnitude, those that could be generated directly by populations of actin filaments that push on the plasma membrane during the process of polymerization (Szymanski and Cosgrove, 2009). Localized cell wall loosening or the assembly of an anisotropic cell wall generates asymmetric yielding responses to turgor-induced cell wall stress (Baskin, 2005; Cosgrove, 2005). Therefore, actin-based control cell shape is indirect, and the actin cytoskeleton influences cell shape change, in part, by actin and/or myosin-dependent trafficking of cargos, including those that control the localized delivery of protein complexes and polysaccharides that pattern the cell wall (Leucci et al., 2007; Gutierrez et al., 2009). In this scheme for actin-based growth control, the actin network dynamically rearranges within the cell to locally position organelles (Cleary, 1995; Gibbon et al., 1999; Szymanski et al., 1999) and to generate organized roadways that define the patterns of intracellular transport at the whole cell spatial scale (Gutierrez et al., 2009; Dyachok et al., 2011).
It has long been known that acto-myosin transport drives long-distance intracellular transport in plant cells, and motor proteins of the myosin XI class track processively toward actin filament plus ends (Tominaga et al., 2003), to deliver cargo organelles or proteins to specific cellular locations. It is likely that all of the plant myosins are plus-end directed, because the plant myosin VIII and XI motors do not have the insertions, within and adjacent to the motor domain, that are thought to cause the unconventional myosin VI to track toward minus ends of actin filaments (Wells et al., 1999; Menetrey et al., 2005). The polarity of actin filaments within actin bundles and the positioning of actin filaments in the cell are therefore likely to be important because the extent to which filament bundles are aligned within a bundle and the positioning of bundles would determine the efficiency with which myosin motors transport cargos to particular locations in the cell (Szymanski and Cosgrove, 2009). For example, Golgi movement requires myosin activity (Boevink et al., 1998; Avisar et al., 2008, 2009; Peremyslov et al., 2008), and there are strong correlations between the location of actin bundles and the motility patterns of the Golgi (Nebenfuhr et al., 1999; Akkerman et al., 2011). Actin bundles are persistent tracks for a variety of organelles, including the endoplasmic reticulum (ER; Sparkes et al., 2009), and in the shoot of young seedlings, most of membrane-associated myosin localizes to a highly motile ER surface (Ueda et al., 2010). It is therefore possible that organelles that are physically associated with the ER, such as the Golgi and perhaps the trans-Golgi network, move by catching a ride with motile ER, and the arrangement of actin bundles in the cell biases the positioning of the secretory pathway to support polarized growth.
This “bundle composition and positioning” control module undoubtedly does not capture the full array of actin-polymerization-dependent activities in the cell, but an importance for bundle composition and positioning in cell shape control is supported by the common observation that actin bundle roadways are not randomly positioned in the cell. In polarized cell types such as leaf trichomes (Szymanski et al., 1999; Le et al., 2003; Deeks et al., 2004; Djakovic et al., 2006) and cylindrical epidermal cells in the root and shoot (Dong et al., 2001; Mathur et al., 2003a; Rahman et al., 2007; Dyachok et al., 2011), the longitudinal alignment of the bundles mirrors the elongated shape of the cells. These bundles tend to be more long-lived structures (Staiger et al., 2009). In addition to defining the general distribution and recycling patterns of organelles in a cell, actin bundles may coordinate the transport of specific cargos. For example, actin bundles and cortical microtubules coordinate the trafficking and insertion of cellulose synthase (CESA)-positive Golgi bodies (Gutierrez et al., 2009), which could allow the cell to maintain the anisotropy of the wall by defining the regions of the cortex with transverse microtubules that receive a continuous supply of CESA, and synthesize cellulose microfibrils with a net transverse alignment.
A major challenge in the field is to determine more broadly the architecture of functionally distinct actin arrays and to discover how the cell uses a diverse collection of actin-binding proteins and filament nucleators to generate these cytoskeletal arrays (Blanchoin et al., 2010). Progress toward this goal is rapidly accelerating: forward and reverse genetic approaches, sophisticated biochemical assays, and live cell imaging are rapidly generating new knowledge about how cytoskeletal proteins orchestrate plant cell responses to endogenous cues and biotic stress, and these topics have been reviewed previously (Smith and Oppenheimer, 2005; Hussey et al., 2006; Yalovsky et al., 2008). This article will focus on a single actin filament-nucleating machine, the actin-related protein (ARP) 2/3 complex, and its relatively simple control in the plant kingdom: positive regulation by a single nucleation promoting factor (NPF) SCAR (suppressor of cAMP receptor) and the WAVE (WASP family verprolin homologous)/SCAR regulatory complex (W/SRC).
ARP2/3 AND THE NEED FOR PROTEINS THAT PROMOTE ACTIN POLYMERIZATION
The rapid initiation and elongation of actin filaments that is observed in vivo is not an intrinsic property of G-actin polymerization. In reactions containing only purified G-actin, the initiation of filament polymerization is slow because trimers of G-actin, which are the seeds for actin polymerization, are rate limiting for the reaction. Eukaryotic cells have evolved an elaborate collection of actin filament nucleators that greatly accelerate filament formation. In plants, the two major known nucleators are the formins (Michelot et al., 2005) and the ARP2/3 complex (Mathur et al., 2003a; Kotchoni et al., 2009). The formin proteins have been reviewed previously (Deeks et al., 2002; Blanchoin and Staiger, 2008), and are a subject of active research (Van Gisbergen et al., 2012). ARP2/3 is an evolutionarily conserved, seven-subunit complex consisting of the actin-related proteins ARP2 and ARP3, and five other distinct subunits, that were originally discovered in Acanthamoeba (Machesky et al., 1994). The ARP2/3 complex can promote actin filament nucleation when it is converted from an inactive “open” conformation to a “closed” active conformation in which the actin-related subunits, ARP2 and ARP3, can form a surface that mimics a stable actin dimer and promotes filament nucleation (Robinson et al., 2001; Rodal et al., 2005). ARP2/3 also has F-actin-binding activity, and nucleates actin filaments from the sides of an existing “mother” actin filament at a characteristic 70° angle (Blanchoin et al., 2000). The integration of ARP2/3 into branched actin filament networks may facilitate the physical anchoring of a branched actin network so that the ends of polymerizing actin filaments can do work on an organelle surface.
In living plant cells, roughly one third of the observed filament nucleation events originate from an existing filament or bundle (Staiger et al., 2009); however, it is not yet known if ARP2/3 is responsible for this activity. In non-plant systems, ARP2/3-generated actin filaments do work and function at many different organelle surfaces to deform membranes. Examples include the generation of dendritic actin networks that either drive or consolidate cell shape change in the lamellipodia of some crawling cell types (Svitkina and Borisy, 1999), the promotion of vesicle scission of tubulated membranes that are associated with the late steps of endocytosis (Kaksonen et al., 2005), and cargo sorting activities of early endosomes (Derivery et al., 2009b; Gomez and Billadeau, 2009). However, the precise function of ARP2/3 in plant cells remains enigmatic. Recently, ARP2/3-specific small molecule inhibitors have been identified (Nolen et al., 2009) and have successfully used to in vivo analyses of ARP2/3 function in a variety animal cells (reviewed in Rotty et al., 2013). If these inhibitors specifically block ARP2/3 function in plant cells, they could facilitate functional analyses of ARP2/3, especially in species in which ARP2/3 mutants are not available.
Based on mutant phenotypes and gene expression patterns, ARP2/3 and the W/SRC participate widely in plant growth and development. W/SRC and ARP2/3 mutants in the moss Physcomitrella patens (Harries et al., 2005; Perroud and Quatrano, 2006), Arabidopsis (Le et al., 2003; Li et al., 2003; Mathur et al., 2003a; Brembu et al., 2004; Deeks et al., 2004), and maize (Frank and Smith, 2002) have demonstrated the broad importance of ARP2/3 and its activation during cell morphogenesis. Tip growing cells have a unique actin-dependent cytoplasmic organization that defines the streaming patterns of the cell and dictates the mechanical properties of the apex by restricting vesicle exchange with the plasma membrane to this region of the tip growing cell (Daher and Geitmann, 2011; Palin and Geitmann, 2012). In moss, ARP2/3 is a critical component of the tip growth machinery, because mutant protonemal cells grow very slowly and with an altered geometry compared to the wild type (Harries et al., 2005; Perroud and Quatrano, 2008). However, ARP2/3 is not universally required during tip growth in higher plants. This is based on the normal transmission of null ARP2/3 alleles through pollen, and the lack of a clear root hair phenotype in Arabidopsis (Le et al., 2003; Djakovic et al., 2006). However, based on reports from two model species that are used for nodulation research, ARP2/3 clearly has a function in some aspects of root hair development because mutation of genes in the ARP2/3 pathway caused a failure of root hairs to develop functional infection threads and normal root nodules (Yokota et al., 2009; Miyahara et al., 2010). An importance for ARP2/3 during cell morphogenesis is more obvious in cells that employ a diffuse growth mechanism. Based on mutant phenotypes in maize and Arabidopsis, the size and shapes of epidermal cells throughout the entire plant are affected (Frank and Smith, 2002; Le et al., 2003; Mathur et al., 2003a). In the distorted class of Arabidopsis ARP2/3 mutants, leaf trichomes are obviously swollen and twisted due to the constrained importance of an organized actin cytoskeleton to maintain polarized growth in this cell type (Szymanski et al., 1999). The distorted mutants and Arabidopsis spike1 (spk1) may also affect the physical properties of the middle lamella and cell–cell adhesion (Qiu et al., 2002). For example, spk1 and the distorted mutants differ from most other morphology mutants in that they display gaps in the shoot epidermis, most frequently at the interface of pavement cells and stomata (Qiu et al., 2002; Le et al., 2003; Mathur et al., 2003a; Zhang et al., 2005; Djakovic et al., 2006). The cell gaps may reflect defective cortical actin-dependent secretion of polysaccharides and/or proteins that promote cell–cell adhesion (Smith and Oppenheimer, 2005; Hussey et al., 2006; Leucci et al., 2007). However, the endogenous cargo that is putatively affected in the distorted mutants is not known, and the possible contribution of mis-regulated cell expansion between adjacent cells needs to be examined further. In the distorted mutants, the relative amount of actin filaments are slightly reduced compared to the wild type (Le et al., 2003) and the distorted phenotypes are relatively mild, suggesting that other nucleators, such as formins generate the bulk of the actin network. In budding yeast, ARP2/3 and formins have largely independent functions, and nucleate endocytic patches and actin cables that facilitate cell polarization, respectively (Evangelista et al., 2002). On the other hand, ARP2/3 and the formin FMNL2 cooperate in lamellipodia to generate fully functional dendritic actin networks (Block et al., 2012). It remains to be determined how plant cells deploy these different classes of nucleators during morphogenesis.
A SIMPLIFIED SCHEME FOR ARP2/3 ACTIVATION IN PLANTS; ONLY WAVE/SCAR
A diverse class of proteins termed NPFs converts inactive ARP2/3 into a potent actin filament-nucleating machine (reviewed in Welch and Mullins, 2002; Stradal and Scita, 2006). For example, WASP (Wiskott-Aldrich syndrome protein)-family proteins were the first endogenous NPFs to be discovered (Rohatgi et al., 1999; Winter et al., 1999; Yarar et al., 1999). WASP-family proteins have a conserved C-terminal WA domain sequential G-actin-binding WASP-homology 2 (WH2) and a signature acidic motif that was shown to be necessary and sufficient for ARP2/3 activation. The same domain was subsequently identified in another ARP2/3 activator termed WAVE (Miki et al., 1998b), and the WA domain continues to provide a way to identify additional ARP2/3 activators such as WHAMM, JMY, and the WAVE/SCAR homologous protein WASH (see the excellent review by Rottner et al., 2010). NPFs are effectors that convert small GTPase and/or lipid signals into spatially and temporally defined ARP2/3 activation responses. NPFs may also employ specific phospholipid- (Rohatgi et al., 2000; Oikawa et al., 2004) or F-actin- (Goode et al., 2001) binding activities to locally concentrate ARP2/3 either on the surface of particular organelles or within particular actin networks, respectively. It is now apparent that metazoan cells use an assortment of heteromeric complexes to couple signal transduction cascades to actin dynamics and multiple organelle surfaces (Stradal and Scita, 2006; Rottner et al., 2010). Current research efforts are focused on identifying the components and cellular control mechanisms of NPF-based signaling and determining exactly how localized ARP2/3 activation within subdomains of organelles affects the dynamics of endogenous proteins and/or lipids.
In the plant kingdom ARP2/3 activation is highly simplified and appears to rely solely on the WAVE/SCAR family of NPFs (hereafter termed SCAR) and the heteromeric WAVE/SCAR regulatory complex (hereafter termed W/SRC; Eden et al., 2002). A cartoon depicting the subunit composition and overall regulatory relationships between W/SRC, ARP2/3, and actin filaments is shown in Figure 1. Evidence for the singular importance of SCAR for ARP2/3 activation in plants is based primarily on genetic data from Arabidopsis: lines that are null for ARP2/3, SCAR, and single copy W/SRC subunit genes have an identical array of equally severe phenotypes (Szymanski, 2005). This result does not exclude the possibility of SCAR-independent pathways in Arabidopsis because not all ARP2/3 phenotypes are known. Furthermore, there is some evidence for additional ARP2/3 activators in the plant kingdom. For example, although searches for WA domain-containing proteins did not reveal additional candidates in Arabidopsis or obvious homologs of WASP, WHAMM, or JMY (D.S., unpublished), two publications centered on the sequence analyses of WASP-family protein evolution report the presence of WASH-homologous proteins in a small number of plant species(Veltman and Insall, 2010; Kollmar et al., 2012). The WASH regulatory complex is an interesting case because each of its subunits is structurally similar to the analogous W/SRC subunit, but the structurally similar protein pairs are so diverged at the sequence level, that sequence comparisons cannot identify any similarity (Jia et al., 2010). With the exception of the green algae Ostreococcus lucimarinus, which appears to encode a homolog of each of the five WASH regulatory complex subunits including a WASH subunit with an intact WA domain, no other plant species has been reported to encode the full set of WASH regulatory complex subunits (Kollmar et al., 2012). In most species with sequenced genomes, WASH complex genes are either absent or exist as fragmented pseudogenes that are unlikely to have a functional importance. If these genome-sequence-based protein sequence predictions are correct, the data indicate that WASH complex genes were present in a common ancestor of plants and metazoans, but loss of WASH genes and retention of W/SRC has occurred widely within the plant kingdom.
FIGURE 1
W/SRC: A SINGULAR RELIANCE ON SCAR IN MOST PLANT SPECIES
In plants, unlike in other systems (Ibarra et al., 2006; Weiner et al., 2006; Anitei et al., 2010), there is no evidence to date, that W/SRC subunits have any functions independent of the SCAR subunit and an ARP2/3 activation pathway. W/SRC regulation is therefore likely to be relatively simple compared to other systems, and more experimentally tractable. The existence of trans-regulating factors for SCAR/WAVE was originally hypothesized because the full-length proteins (Machesky et al., 1999), unlike the autoinhibited NPF N-WASP (Miki et al., 1998a), are intrinsically active and potentially disruptive to the cell if not properly regulated. A biochemical search for trans-regulating factors led to the original identification of the five subunits of the W/SRC (Eden et al., 2002). Shortly thereafter, forward genetic screens in Arabidopsis based on a distorted trichome phenotype identified homologs of both the W/SRC and ARP2/3 complex subunits (Figure 1).
In general, the signaling proteins and regulatory schemes that control NPF activity are not well understood. In the case of the W/SRC, it is a known ROP (Rho-of-Plants)/Rac effector complex that converts ROP/Rac-GTP and other signals into a localized ARP2/3 activation response (Miki et al., 1998b; Basu et al., 2004; Uhrig et al., 2007). The exact nature of the cellular control of the W/SRC–ARP2/3 pathway is complex and poorly understood (see also below); however, a direct physical interaction between active ROP/Rac proteins and the W/SRC subunit SRA1 appears to be evolutionarily conserved and an important aspect of pathway control (Basu et al., 2004; Lebensohn and Kirschner, 2009; Chen et al., 2010). There was an initial period of controversy concerning a proposed mechanism of Rac-dependent W/SRC disassembly and loss of WAVE/SCAR trans-inhibition (Eden et al., 2002). However, it is now apparent that vertebrate W/SRC is intrinsically inactive (Derivery et al., 2009a; Ismail et al., 2009), and the genetic data in Arabidopsis are completely consistent with the plant W/SRC being intrinsically inactive (Szymanski, 2005). Ligands such as Rac (Chen et al., 2010), and perhaps specific phospholipids (Lebensohn and Kirschner, 2009), cause conformational changes in vertebrate W/SRC that allow it to activateARP2/3. A recent crystallographic analysis of the vertebrate W/SRC reveals a plausible mechanism for ROP/Rac positive regulation of W/SRC, in which the active forms of the small GTPase and the WA domain of SCAR bind to the same region of the SRA1 subunit (Chen et al., 2010). Active ROP/Rac proteins may therefore antagonize trans-inhibition of the SCAR subunit that is assembled into W/SRC, and promote conformational changes in the complex that can lead to ARP2/3 activation (Figure 2B). It is important to add that high concentrations of Rac are required to fully activate W/SRC in vitro, and additional ligands (Lebensohn and Kirschner, 2009; Koronakis et al., 2011) and protein phosphorylation control (Ura et al., 2012) may also be required to fully activate W/SRC in cells. The function of the W/SRC is therefore to integrate multiple signaling inputs to determine where and when the SCAR subunit activates ARP2/3.
FIGURE 2
SCAR: MULTIPLE DOMAINS MEDIATING W/SRC ASSEMBLY AND ARP2/3 ACTIVATION
The complexity of SCAR regulation is reflected in the presence of multiple conserved domains with distinct functional roles. The SCAR WA domain is the best characterized and contains highly conserved elements (Panchal et al., 2003) that are preserved throughout evolution as hallmarks of ARP2/3 activators (Basu et al., 2005). The WA domain binds to both G-actin and the ARP2/3 complex (Marchand et al., 2001), and both activities are detected with plant SCARs (Deeks et al., 2004; Frank et al., 2004; Basu et al., 2005; Uhrig et al., 2007). In fact, plant SCARs were first identified based on the presence of a WA domain in several maize and Arabidopsis proteins and the ability of purified WA fragments to activate vertebrate ARP2/3 (Frank et al., 2004). All plant SCARs contain an intact WA domain (Figure 3); however, they differ in the efficiency with which they activate ARP2/3. For example, in one comparative study Zea mays SCAR1 potently activated ARP2/3, whereas Arabidopsis SCAR4 had limited activity (Frank et al., 2004). Based on a genetic and biochemical study of SCARs in Arabidopsis, the efficiency with which different SCARs activate ARP2/3 is correlated with the relative importance of individual SCAR genes in vivo (Zhang et al., 2008).
FIGURE 3
Plant SCARs are usually encoded by small gene families, unlike many of the other W/SRC and ARP2/3 subunit genes, which are often single copy. For example, Arabidopsis encodes four functional SCAR isoforms, and DISTORTED3/IRREGULAR TRICHOME BRANCH 1/SCAR2 was the first to be identified genetically because mutations in SCAR2 were sufficient to cause a mild distorted trichome phenotype (Basu et al., 2005; Zhang et al., 2005). The overall domain organization of SCAR2 is similar to other SCARs present in lower plants such as the moss P. patens and grass species such as maize (Figure 3). All plant SCARs have a C-terminal WA domain and a conserved N-terminal SHD (SCAR homology domain; Figure 3). SHD is involved in W/SRC assembly, and mediates direct physical interactions with the W/SRC subunits ABIL1 (ABL interactor like protein 1; Basu et al., 2005) and BRK1 (Frank et al., 2004). The physical interaction of SHD with BRK1 is highly significant, because BRK1 specifically stabilizes SCAR proteins (Djakovic et al., 2006; Le et al., 2006). Plant SCARs also contain a cluster of basic amino acids just C-terminal to the SHD (Figure 3). In non-plant systems, the basic region has been proposed to determine the localization of SCARs by binding to PtdIns (3,4,5) P3 (Oikawa et al., 2004) and to mediate auto-inhibitory ionic interactions with the WA domain that occur when WA is highly phosphorylated (Ura et al., 2012). However, the importance of the basic region in plant SCARs is not known. The distinguishing feature of plant SCARs is the presence of a large and highly variable central region (Figure 3). Unlike the central regions of vertebrate WAVE, which is dominated by a proline rich region (Figure 3), that binds to both the G-actin-binding protein profilin and Src homology 3-domain-containing signaling proteins (Miki et al., 1998b), plant SCARs lack a large proline rich region; however, they do contain a short conserved proline rich motif at the near C-terminus that may have a functional importance. A comprehensive bioinformatics analysis of the WAVE/SCAR family proteins identified several conserved sequence features within the plant SCAR central region that merit further study (Kollmar et al., 2012). We used the sequences by Kollmar et al. (2012) (Table 1) to map the motifs onto a selected set of known plant SCAR proteins. In order to create a consistent nomenclature, these regions of conserved sequences are referred to as SCAR of plants central region (SPC) 1 through 4. The conserved regions are numbered according to their order of occurrence within AtSCAR1, AtSCAR3, and ZmSCAR1. The restricted occurrences of SPC2 and SPC3 within a subset of plant SCARs is consistent with previous phylogenetic analyses that defined two clades of plant SCARs based on an analysis of the SHD and WA domains (Zhang et al., 2008). The SPCs are not detected in the moss protein PpSCAR1, suggesting that these motifs evolved to carry out functions that are unique to higher plants.
Table 1
| SPC1 | SDGSHSDDIESEVDNYMDALNTMESESETDNECQTKR | |
| (=WAM1*) | ||
| SPC2 | SSSCESQESLAESSSVHSVKFWTNGGLLGLEPSKPPDFAVSNSL | |
| (=WAM3) | ||
| SPC3 | GLGHRLLINGFQRKVSLVHDDLKMEPASSLKSGALEQESGHNSVGY | |
| (=WAM4) | QAEPETTFKEQFGNKTENGMDGLSKSSIFGSPIDSLPSSPPLEHMK | |
| ISFHPIDGFETSKLKLKFPDGNHHESVRDMFPSFQLVPEPSIPLHDSG | ||
| SDSDDDDTFCRSSPYMSDDCLSHHSESNSSEQWESD | ||
| SPC4 | EMPPPPPLPPMQWRLGKPQLGSLEEK | |
| (=WAM2) |
Amino acid sequences used for motif search in plant SCARs.
Nomenclature used by Kollmar et al. (2012) is shown in parentheses.
THE GENETICS AND CELL BIOLOGY OF SCAR IN Arabidopsis
Thorough genetic analyses of the SCAR gene family showed that, despite the clear differences in amino acid sequence among the SCARs, the proteins are functionally interchangeable in the context of ARP2/3-dependent cell shape control. For example, functional redundancy among SCARs was the likely explanation of the relatively weak trichome phenotype of scar2 (Basu et al., 2005). Subsequent analyses of the Arabidopsis SCAR gene family revealed surprising and informative regulatory relationships. In one paper, it was shown that although scar4 trichomes had no phenotype, scar2;scar4 double mutants had severely distorted trichomes that were more severe than scar2 alone and similar to those of null arp2/3 mutants (Uhrig et al., 2007). The cell type-specific phenotypes were hypothesized to be due to isoform-specific functions of SCARs and the assembly of functionally distinct types of W/SRCs. Subsequently, a comprehensive genetic analysis of the SCAR gene family and ectopic expression of a SCAR3 showed that, although cell types differed with respect to the relative importance of different SCARs, the genes can function interchangeably (Zhang et al., 2008). The importance of individual SCARs within a cell type correlated with gene expression levels and with the biochemical efficiency with which an individual isoform would activate ARP2/3. These data are the basis for a SCAR activity threshold model (Zhang et al., 2008), in which cell types have differing requirements for ARP2/3 activation, and any combination of SCARs can be used to adequately activate ARP2/3. The cellular explanations of cell type-specific differences for ARP2/3 activation remain to be determined.
SCARs are subjected to multiple levels of post-translational control. One is at the level of protein stability. In most non-plant systems all W/SRC subunits have a mutually dependent protein stability, and removal of any one subunit strongly decreases the protein levels of all of the other subunits (Derivery and Gautreau, 2010). This is not the case in Arabidopsis, as loss of BRK1/HSPC300 specifically destabilizes SCAR2, but not the W/SRC subunit NAP1 (nucleosome assembly protein 1; Le et al., 2006). In contrast, SCAR2 is not degraded in the nap1 or sra1 null backgrounds. SCAR2 is not ectopically active in nap1 and sra1, because these mutants have loss of function cell shape and actin cytoskeleton phenotypes (Basu et al., 2004; Brembu et al., 2004; Deeks et al., 2004; El-Assal et al., 2004; Li et al., 2004). This indicates that the pool of SCAR in the mutants has little or no biological activity, and stable SCAR or BRK1–SCAR sub-complexes in nap1 and sra1 are subject to additional levels of negative regulation (Figure 2A). The response of SCAR to loss of SRA1 in Arabidopsis differs from that of the amoebae Dictyostelium. In this organism, SCAR levels are greatly reduced in sra1, but the residual SCAR is hyperactive, ectopically activating ARP2/3 actin meshwork formation (Blagg et al., 2003). In plants, W/SRC assembly may be an important point of control in terms of defining the cellular levels of fully assembled complex. It is also possible that reversible W/SRC assembly could play an important regulatory role as W/SRC is cycled through multiple rounds of activation, use, and inactivation. Although the concept of reversible W/SRC assembly is controversial (Bompard and Caron, 2004), the potential regulatory importance of complex assembly deserves further study (Derivery and Gautreau, 2010).
BRK1 is an interesting ~8 kDa evolutionarily conserved W/SRC subunit that may be involved in determining the cellular levels of SCAR and the extent to which it is fully assembled into the W/SRC (Derivery et al., 2008). Plant BRK1 was first cloned in maize based on the reduced crenulation of epidermal cells of the brick1 mutant (Frank and Smith, 2002). It was subsequently shown that BRK1 physically interacts with the conserved N-terminal SHD of SCAR (Frank and Smith, 2002). The idea that BRK1 masks a structural feature in the SCAR SHD that otherwise promotes proteasome-dependent protein turnover remains untested (Le et al., 2006), and in our hands proteasome inhibitors do not rescue brk1 shoot phenotypes (D.S., unpublished). However, it was recently shown that the proteasome inhibitor MG132 can stabilize a nuclear localized pool of SCAR, and constitutive photomorphogenic 1(COP1)- and proteasome-dependent turnover of SCAR in root cells is associated with reduced elongation in etiolated seedlings (Dyachok et al., 2011). It is possible that BRK1 and proteolytic pathways operate antagonistically to define the cellular concentration of BRK1–SCAR sub-complexes that may participate in W/SRC assembly and ARP2/3 activation (Figure 2).
Most research has focused on fully assembled W/SRC, which is widely regarded to be the entity that converts cellular signals into an ARP2/3 activation response (Steffen et al., 2004; Chen et al., 2010). The crystal structure for vertebrate W/SRC was recently solved and provided insight into the mechanism of trans-inhibition, in which the SRA1 subunit of W/SRC physically interacts with the SCAR-WA domain, and sterically inhibits a physical interaction with ARP2/3. GTP-bound Rac was shown to bind to the same region of SRA1 and provides a plausible mechanism for activation via relief of trans-inhibition. However, the nature of W/SRC positive regulation remains poorly understood because high concentrations of Rac-GTP are required for activation, and in other systems multiple sources for W/SRC positive regulation have been identified (Ismail et al., 2009; Lebensohn and Kirschner, 2009; Koronakis et al., 2011; Ura et al., 2012).
The vertebrate W/SRC structure and its regulation are relevant to plants, because the subunits, complex assembly mechanisms, and regulatory schemes of W/SRC–ARP2/3 pathway in Arabidopsis and Physcomitrella are conserved compared with vertebrate species (Szymanski, 2005). For example, plant genomes encode subunits of each of the W/SRC subunits, and transgene-rescue experiments in Arabidopsis indicate that human W/SRC complex subunits can substitute for the Arabidopsis proteins (Basu et al., 2004; El-Assal et al., 2004). Furthermore, biochemical assays of Arabidopsis W/SRC have shown that the binary interactions among W/SRC subunits that mediate complex assembly are indistinguishable from those that have been observed for human W/SRC (Gautreau et al., 2004) and are mediated by conserved domains within the individual subunits (Basu et al., 2004; El-Assal et al., 2004; Frank et al., 2004; Le et al., 2006; Uhrig et al., 2007).
The mechanism by which active ROP is coupled to W/SRC is being resolved. In non-plant systems the identity of the GEF (guanine nucleotide exchange factor) that transmits activating Rac signals to W/SRC is not known. In Arabidopsis, the DOCK (dedicator of cytokinesis)-family GEF SPK1 functions as an upstream activator of ROP and W/SRC based on genetic epistasis tests and a physical association of endogenous SPK1 with W/SRC complex subunits (Basu et al., 2008). This conclusion is further supported by the detection of a yeast 2-hybrid interaction between SPK1 and the ABIL W/SRC subunit (Uhrig et al., 2007), which is a known W/SRC subunit (Jorgens et al., 2010) that physically interacts with SCAR (Basu et al., 2005). We propose a model in which SPK1 is a transient component of fully assembled W/SRC complexes that transmits activating ROP-GTP signals that antagonize SRA1-dependent trans-inhibition of SCAR (Figure 2B). The involvement of ROPs in trichome morphogenesis has been difficult to determine because so many ROPs are expressed in trichomes (Marks et al., 2009), and recessive ROP mutants with clear trichome phenotypes have yet to be reported, even though some have an effect on pavement cell shape (Fu et al., 2005; Xu et al., 2010). A recent report describes a clever strategy to generate ROP loss of function lines that used the ectopic expression of ROP-specific bacterial toxins. There was a strong association between inducible expression of the toxins and the appearance of trichomes with severe trichome swelling and reduced branch number phenotypes (Singh et al., 2012). Given the involvement of ROPs, the identification of a ROPGEF SPK1 (Qiu et al., 2002; Basu et al., 2008), and ROP effectors in the W/SRC–ARP2/3 pathway (Basu et al., 2004; Uhrig et al., 2007), it is now possible to construct detailed biochemical and genetic models for pathway control (Figure 2). The major challenge now is centered on learning how plant cells deploy these important growth-controlling machines.
POTENTIAL MECHANISMS FOR THE CELLULAR CONTROL OF W/SRC AND ARP2/3
Localization data from non-plant systems suggest that W/SRC is partitioned between active and inactive pools. For example, in cultured human cell lines that crawl on a solid substrate, current models propose that a cytosolic pool of inactive SCAR proteins and W/SRC are locally recruited and activated at specific plasma membrane surfaces in response to activating signals (Oikawa et al., 2004; Lebensohn and Kirschner, 2009; Chen et al., 2010). However, in Drosophila neurons (Bogdan and Klambt, 2003) and cultured human melanoma cells (Steffen et al., 2004), there are large pools of W/SRC with a perinuclear and organelle-like punctate localization that have no obvious relationship to cell shape or motility, raising uncertainty about the cellular mechanisms of W/SRC activation and the importance of different organelle systems. In plants, cell fractionation experiments indicate that SCAR1 and ARP2/3 have an increased association with membranes compared with their animal counterparts (Dyachok et al., 2008; Kotchoni et al., 2009). In tip growing moss protonemal cells, both BRK1 and ARP2/3 localize to a population of unidentified organelles within the apical zone (Perroud and Quatrano, 2008). Similar live cell imaging experiments in Arabidopsis reported a plasma membrane localization for SCAR1 and BRK1 in a variety of shoot epidermal and root cortex, and their accumulation at young trichome branch tips and at 3-way cell wall junctions may define subcellular domains for W/SRC–ARP2/3-dependent actin filament nucleation at the plasma membrane (Dyachok et al., 2008). However, to our knowledge, active W/SRC, defined here as the fraction of W/SRC that colocalizes with ARP2/3 or actin, has not been reported in plants, and the plasma membrane is not necessarily the only organelle involved in W/SRC regulation. For example, the reported accumulation of BRK1 and SCAR1 at 3-way cell wall junctions has a punctate appearance at the cell cortex that may not simply correspond to the plasma membrane (Dyachok et al., 2008). Also, in young stage 4 trichomes, there was an uncharacterized pool of intracellular SCAR1, but not BRK1, that localized to intracellular punctate structures (Dyachok et al., 2008). The ER may also be involved in W/SRC regulation. SPK1, the known upstream regulator W/SRC is localized to specialized domains of the ER termed ER exit sites (Zhang et al., 2010). We recently discovered a large pool of inactive NAP1 and SCAR2 on the ER surface. NAP1 localization in mutant backgrounds and colocalization with actin clearly showed that the ER-localized pool is probably inactive with respect to full W/SRC assembly and ARP2/3 activation (Zhang et al., 2013). These results provide additional support for the importance of the ER surface in the control of W/SRC regulation.
We propose that multiple organelles participate in W/SRC regulation and function, and that full activation and deployment of the complex occurs in multiple stages because the localization patterns of BRK1, SCAR, and NAP1 in identical cell types do not completely overlap (Dyachok et al., 2008, 2011; D.S. and C.Z., unpublished). We also propose that pools of W/SRC sub-complexes exist (Figure 2), but it will be important to determine the extent to which the different localization patterns among the subunits are explained by either real differences among the subunits in their assembly status or artifacts due to the particular localization methods and/or the particular fluorescent protein fusions that are used. The ER surface appears to be a general platform that accumulates W/SRC subunits in either an unassembled or partially assembled state. It is possible that full complex assembly and the initial SPK1-dependent loading of ROP into the W/SRC occur at specialized subdomains of the ER that also contain components of COPII-dependent ER-export.
If the ER and ERES (ER exit sites) are sites for W/SRC positive regulation, this would raise many interesting questions regarding the biological rationale for using the ERES as a hub for ROP-dependent signal transduction and actin polymerization. At present the importance of actin filaments associated with ERES is unclear. The vesicle transport from ER to the Golgi does not strictly require an intact actin cytoskeleton (Saint-Jore et al., 2002), and in general there is limited colocalization between the ER and actin networks (Ueda et al., 2010). It may be that ARP2/3 is activated at specific sub-domains of the ER to either polymerize actin filaments that do work and promote localized membrane tubulation or vesicle formation. It is also conceivable that ARP2/3 generates stable ER-associated actin meshworks that could act as a scaffolding element that recruits other actin-binding proteins and motor proteins that control organelle positioning or biogenesis. On the other hand, the ER surface may not be a site for ARP2/3 activation. Perhaps, the ER-associated W/SRC is not fully activated, and there is a spatial uncoupling of early SPK1-dependent positive regulation of W/SRC at the ER surface. The ultimate full activation of W/SRC and ARP2/3 complexes may occur at some other membrane surface. Clearly additional localization and live cell imaging studies are needed to define more precisely the locations of active ARP2/3 and its importance in terms of actin cytoskeleton reorganization and growth control.
FUTURE PERSPECTIVES
The knowledge base concerning the components and regulation of the plant W/SRC and ARP2/3 pathway is approaching what is needed to predict and manipulate the signaling inputs and actin polymerization outputs of the pathway. Further research efforts in this area could have value, not only as a test case for engineering the plant cytoskeleton, but also as a strategy to improve the value of crop species. W/SRC–ARP2/3 is involved in so many processes that contribute to important crop traits such as stomatal dynamics and water use efficiency (Jiang et al., 2012), infection thread formation during the process of root nodulation (Yokota et al., 2009; Miyahara et al., 2010; Hossain et al., 2012), and cellular growth control that impacts organ architecture and the adhesive properties of cells in the context of a tissue (Mathur et al., 2003b). The current barrier to meeting these lofty goals is a lack of sufficient details concerning the precise cellular function of ARP2/3-generated actin filaments in plant cells.
Statements
Acknowledgments
Research in the lab of D.B.S. is supported by the National Science Foundation under Grant No. MCB-1121893, IOS-1127027, and IOS-1249652 and the Department of Energy-sponsored Center for Direct Catalytic Conversion of Biomass to Biofuels (C3Bio) an Energy Frontiers Research Center (DE-SC0000997).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Abbreviations
- ABIL
ABLinteractor like protein
- ADF
ADF, actin-depolymerizing factor
- ARP2/3
actin-related protein 2/3 complex
- CESA
cellulose synthase
- ERES
ER exit sites; F-actin, filamentous actin; G-actin, globular actin
- GEF
guanine nucleotide exchange factor
- NPF
nucleation promoting factor
- ROP
Rho-of-Plants
- SCAR
suppressor of cAMP receptor
- SHD
SCAR homology domain
- WASP
Wiskott-Aldrich syndrome protein
- WAVE
WASP family verprolin homologous.
REFERENCES
1
AkkermanM.OverdijkE. J. R.SchelJ. H. N.EmonsA. M. C.KetelaarT. (2011). Golgi body motility in the plant cell cortex correlates with actin cytoskeleton organization.Plant Cell Physiol.521844–1855. 10.1093/pcp/pcr122
2
AniteiM.StangeC.ParshinaI.BaustT.SchenckA.RaposoG.et al (2010). Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the TGN.Nat. Cell Biol.12330–340. 10.1038/ncb2034
3
AvisarD.Abu-AbiedM.BelausovE.SadotE.HawesC.SparkesI. A. (2009). A comparative study of the involvement of 17 Arabidopsis Myosin family members on the motility of Golgi and other organelles.Plant Physiol.150700–709. 10.1104/pp.109.136853
4
AvisarD.ProkhnevskyA. I.DoljaV. V. (2008). Class VIII myosins are required for plasmodesmatal localization of a closterovirus Hsp70 homolog.J. Virol.822836–2843. 10.1128/JVI.02246-07
5
BaskinT. I. (2005). Anisotropic expansion of the plant cell wall.Annu. Rev. Cell Dev. Biol.21203–222. 10.1146/annurev.cellbio.20.082503.103053
6
BasuD.El-AssalS. E.LeJ.MalleryE. L.SzymanskiD. B. (2004). Interchangeable functions of Arabidopsis PIROGI and the human WAVE complex subunit SRA1 during leaf epidermal development.Development1314345–4355. 10.1242/dev.01307
7
BasuD.LeJ.El-AssalS. E.HuangS.ZhangC.MalleryE. L.et al (2005). DISTORTED3/SCAR2 is a putative Arabidopsis WAVE complex subunit that activates the Arp2/3 complex and is required for epidermal morphogenesis.Plant Cell17502–524. 10.1105/tpc.104.027987
8
BasuD.LeJ.ZakharovaT.MalleryE. L.SzymanskiD. B. (2008). A SPIKE1 signaling complex controls actin-dependent morphogenesis through the WAVE and ARP2/3 complexes.Proc. Natl. Acad. Sci. U.S.A.1054044–4049. 10.1073/pnas.0710294105
9
BlaggS. L.StewartM.SamblesC.InsallR. H. (2003). PIR121 regulates pseudopod dynamics and SCAR activity in Dictyostelium.Curr. Biol.131480–1487. 10.1016/S0960-9822(03)00580-3
10
BlanchoinL.AmannK. J.HiggsH. N.MarchandJ. B.KaiserD. A.PollardT. D. (2000). Direct observation of dendritic actin filament networks nucleated by Arp2/3 complex and WASP/Scar proteins.Nature4041007–1011. 10.1038/35010008
11
BlanchoinL.Boujemaa-PaterskiR.HentyJ. L.KhuranaP.StaigerC. J. (2010). Actin dynamics in plant cells: a team effort from multiple proteins orchestrates this very fast-paced game.Curr. Opin. Plant Biol13714–723. 10.1016/j.pbi.2010.09.013
12
BlanchoinL.StaigerC. J. (2008). Plant formins: Diverse isoforms and unique molecular mechanism.Biochim. Biophys. Acta201–206. 10.1016/j.bbamcr.2008.09.015
13
BlockJ.BreitsprecherD.KühnS.WinterhoffM.KageF.GeffersR.et al (2012). FMNL2 drives actin-based protrusion and migration downstream of Cdc42.Curr. Biol.221005–1012. 10.1016/j.cub.2012.03.064
14
BoevinkP.OparkaK.Santa CruzS.MartinB.BetteridgeA.HawesC. (1998). Stacks on tracks: the plant Golgi apparatus traffics on an actin/ER network.Plant J.15441–447. 10.1046/j.1365-313X.1998.00208.x
15
BogdanS.KlambtC. (2003). Kette regulates actin dynamics and genetically interacts with Wave and Wasp.Development1304427–4437. 10.1242/dev.00663
16
BompardG.CaronE. (2004). Regulation of WASP/WAVE proteins: making a long story short.J. Cell Biol.166957–962. 10.1083/jcb.200403127
17
BrembuT.WingeP.SeemM.BonesA. M. (2004). NAPP and PIRP encode subunits of a putative wave regulatory protein complex involved in plant cell morphogenesis.Plant Cell162335–2349. 10.1105/tpc.104.023739
18
ChenZ.BorekD.PadrickS. B.GomezT. S.MetlagelZ.IsmailA. M.et al (2010). Structure and control of the actin regulatory WAVE complex.Nature468533–538. 10.1038/nature09623
19
ClearyA. L. (1995). F-actin redistributions at the division site in living Tradesantia stomatal complexes as revealed by microinjection of rhodamine-phalloidin.Protoplasma185152–165. 10.1007/BF01272855
20
CosgroveD. J. (2005). Growth of the plant cell wall.Nat. Rev. Mol. Cell Biol.6850–861. 10.1038/nrm1746
21
DaherB.GeitmannA. (2011). Actin is involved in pollen tube tropism through redefining the spatial targeting of secretory vesicles.Traffic121537–1551. 10.1111/j.1600-0854.2011.01256.x
22
DeeksM. J.HusseyP. J.DaviesB. (2002). Formins: intermediates in signal-transduction cascades that affect cytoskeletal reorganization.Trends Plant Sci.7492–498. 10.1016/S1360-1385(02)02341-5
23
DeeksM. J.KaloritiD.DaviesB.MalhoR.HusseyP. J. (2004). Arabidopsis NAP1 is essential for ARP2/3-dependent trichome morphogenesis.Curr. Biol.141410–1414. 10.1016/j.cub.2004.06.065
24
DeriveryE.FinkJ.MartinD.HoudusseA.PielM.StradalT. E.et al (2008). Free Brick1 is a trimeric precursor in the assembly of a functional Wave complex.PLoS ONE 3:e2462. 10.1371/journal.pone.0002462
25
DeriveryE.GautreauA. (2010). Generation of branched actin networks: assembly and regulation of the N-WASP and WAVE molecular machines.BioEssays32119–131. 10.1002/bies.200900123
26
DeriveryE.LombardB.LoewD.GautreauA. (2009a). The Wave complex is intrinsically inactive.Cell Motil. Cytoskeleton66777–790. 10.1002/cm.20342
27
DeriveryE.SousaC.GautierJ. J.LombardB.LoewD.GautreauA. (2009b). The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex.Dev. Cell17712–723. 10.1016/j.devcel.2009.09.010
28
DjakovicS.DyachokJ.BurkeM.FrankM. J.SmithL. G. (2006). BRICK1/HSPC300 functions with SCAR and the ARP2/3 complex to regulate epidermal cell shape in Arabidopsis.Development1331091–1100. 10.1242/dev.02280
29
DongC. H.XiaG. X.HongY.RamachandranS.KostB.ChuaN. H. (2001). ADF proteins are involved in the control of flowering and regulate F-actin organization, cell expansion, and organ growth in Arabidopsis.Plant Cell131333–1346. 10.1105/TPC.010051
30
DyachokJ.ShaoM.-R.VaughnK.BowlingA.FacetteM.DjakovicS.et al (2008). Plasma membrane-associated SCAR complex subunits promote cortical F-actin accumulation and normal growth characteristics in Arabidopsis roots.Mol. Plant1990–1006. 10.1093/mp/ssn059
31
DyachokJ.ZhuL.LiaoF.HeJ.HuqE.BlancaflorE. B. (2011). SCAR mediates light-induced root elongation in Arabidopsis through photoreceptors and proteasomes.Plant Cell233610–3626. 10.1105/tpc.111.088823
32
EdenS.RohatgiR.PodtelejnikovA. V.MannM.KirschnerM. W. (2002). Mechanism of regulation of WAVE1-induced actin nucleation by Rac1 and Nck.Nature418790–793. 10.1038/nature00859
33
El-AssalS. E.LeJ.BasuD.MalleryE. L.SzymanskiD. B. (2004). Arabidopsis GNARLED encodes a NAP125 homologue that positively regulates ARP2/3.Curr. Biol.141405–1409. 10.1016/j.cub.2004.06.062
34
EvangelistaM.PruyneD.AmbergD. C.BooneC.BretscherA. (2002). Formins direct Arp2/3-independent actin filament assembly to polarize cell growth in yeast.Nat. Cell Biol.4260–269. 10.1038/ncb718
35
FrankM.EgileC.DyachokJ.DjakovicS.NolascoM.LiR.et al (2004). Activation of Arp2/3 complex-dependent actin polymerization by plant proteins distantly related to Scar/WAVE.Proc. Natl. Acad. Sci. U.S.A.1616379–16384. 10.1073/pnas.0407392101
36
FrankM. J.SmithL. G. (2002). A small, novel protein highly conserved in plants and animals promotes the polarized growth and division of maize leaf epidermal cells.Curr. Biol.12849–853. 10.1016/S0960-9822(02)00819-9
37
FuY.GuY.ZhengZ.WasteneysG. O.YangZ. (2005). Arabidopsis interdigitating cell growth requires two antagonistic pathways with opposing action on cell morphogenesis.Cell11687–700. 10.1016/j.cell.2004.12.026
38
GautreauA.HoH. H.SteenH.GygiS. P.KirschnerM. W. (2004). Purification and architecture of the ubiquitous Wave complex.Proc. Natl. Acad. Sci. U.S.A.1014379–4383. 10.1073/pnas.0400628101
39
GibbonB. C.KovarD. R.StaigerC. J. (1999). Latrunculin B has different effects on pollen germination and tube growth.Plant Cell112349–2363. 10.1105/tpc.11.12.2349
40
GomezT. S.BilladeauD. D. (2009). A FAM21-containing WASH complex regulates retromer-dependent sorting.Dev. Cell17699–711. 10.1016/j.devcel.2009.09.009
41
GoodeB. L.RodalA. A.BarnesG.DrubinD. G. (2001). Activation of the Arp2/3 complex by the actin filament bonding protein Abp1p.J. Cell Biol.153627–634. 10.1083/jcb.153.3.627
42
GutierrezR.LindeboomJ. J.ParedezA. R.EmonsA. M.EhrhardtD. W. (2009). Arabidopsis cortical microtubules position cellulose synthase delivery to the plasma membrane and interact with cellulose synthase trafficking compartments.Nat. Cell Biol.797–806. 10.1038/ncb1886
43
HarriesP. A.PanA.QuatranoR. S. (2005). Actin-related protein2/3 complex component ARPC1 is required for proper cell morphogenesis and polarized cell growth in Physcomitrella patens.Plant Cell172327–2339. 10.1105/tpc.105.033266
44
HentyJ. L.BledsoeS. W.KhuranaP.MeagherR. B.DayB.BlanchoinL.et al (2011). Arabidopsis actin depolymerizing factor4 modulates the stochastic dynamic behavior of actin filaments in the cortical array of epidermal cells.Plant Cell233711–3726. 10.1105/tpc.111.090670
45
HossainM. S.LiaoJ.JamesE. K.SatoS.TabataS.JurkiewiczA.et al (2012). Lotus japonicus ARPC1 is required for rhizobial infection.Plant Physiol.160917–928. 10.1104/pp.112.202572
46
HusseyP. J.KetelaarT.DeeksM. J. (2006). Control of the actin cytoskeleton in plant cell growth.Annu. Rev. Plant Biol.57109–125. 10.1146/annurev.arplant.57.032905.105206
47
IbarraN.BlaggS. L.VazquezF.InsallR. H. (2006). Nap1 regulates Dictyostelium cell motility and adhesion through SCAR-dependent and -independent pathways.Curr. Biol.16717–722. 10.1016/j.cub.2006.02.068
48
IsmailA. M.PadrickS. B.ChenB.UmetaniJ.RosenM. K. (2009). The WAVE regulatory complex is inhibited.Nat. Struct. Mol. Biol.16561–563. 10.1038/nsmb.1587
49
JiaD.GomezT. S.MetlagelZ.UmetaniJ.OtwinowskiZ.RosenM. K.et al (2010). WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASH) family are controlled by analogous structurally related complexes.Proc. Natl. Acad. Sci. U.S.A.10710442–10447. 10.1073/pnas.0913293107
50
JiangK.SorefanK.DeeksM. J.BevanM. W.HusseyP. J.HetheringtonA. M. (2012). The ARP2/3 complex mediates guard cell actin reorganization and stomatal movement in Arabidopsis.Plant Cell242031–2040. 10.1105/tpc.112.096263
51
JorgensC. I.GrunewaldN.HulskampM.UhrigJ. F. (2010). A role for ABIL3 in plant cell morphogenesis.Plant J.62925–935. 10.1111/j.1365-313X.2010.04210.x
52
KaksonenM.SunY.DrubinD. G. (2003). A pathway for association of receptors, adaptors, and actin during endocytic internalization.Cell115475–487. 10.1016/S0092-8674(03)00883-3
53
KaksonenM.ToretC. P.DrubinD. G. (2005). A modular design for the Clathrin- and Actin-Mediated endocytosis machinery.Cell123305–320. 10.1016/j.cell.2005.09.024
54
KollmarM.LbikD.EngeS. (2012). Evolution of the eukaryotic ARP2/3 activators of the WASP family: WASP, WAVE, WASH, and WHAMM, and the proposed new family members WAWH and WAML.BMC Res. Notes5:88. 10.1186/1756-0500-5-88
55
KonopkaC. A.BednarekS. Y. (2008). Variable-angle epifluorescence microscopy: a new way to look at protein dynamics in the plant cell cortex.Plant J.53186–196. 10.1111/j.1365-313X.2007.03306.x
56
KoronakisV.HumeP. J.HumphreysD.LiuT.HorningO.JensenO. N.et al (2011). WAVE regulatory complex activation by cooperating GTPases Arf and Rac1.Proc. Natl. Acad. Sci. U.S.A.10814449–14454. 10.1073/pnas.1107666108
57
KotchoniS. O.ZakharovaT.MalleryE. L.LeJ.El-AssalS. E.SzymanskiD. B. (2009). The association of the Arabidopsis actin-related protein (ARP) 2/3 complex with cell membranes is linked to its assembly status, but not its activation.Plant Physiol.1512095–2109. 10.1104/pp.109.143859
58
LeJ.El-AssalS. E.BasuD.SaadM. E.SzymanskiD. B. (2003). Requirements for Arabidopsis ATARP2 and ATARP3 during epidermal development.Curr. Biol.131341–1347. 10.1016/S0960-9822(03)00493-7
59
LeJ.MalleryE. L.ZhangC.BrankleS.SzymanskiD. B. (2006). Arabidopsis BRICK1/HSPC300 is an essential WAVE-complex subunit that selectively stabilizes the Arp2/3 activator SCAR2.Curr. Biol.16895–901. 10.1016/j.cub.2006.03.061
60
LebensohnA. M.KirschnerM. W. (2009). Activation of the WAVE complex by coincident signals controls actin assembly.Mol. Cell36512–524. 10.1016/j.molcel.2009.10.024
61
LeucciM. R.Di SansebastianoG.-P.GiganteM.DalessandroG.PiroG. (2007). Secretion marker proteins and cell-wall polysaccharides move through different secretory pathways.Planta2251001–1017. 10.1007/s00425-006-0407-9
62
LiS.BlanchoinL.YangZ.LordE. M. (2003). The putative Arabidopsis Arp2/3 complex controls leaf cell morphogenesis.Plant Physiol.1322034–2044. 10.1104/pp.103.028563
63
LiY.SorefanK.HemmannG.BevanM. W. (2004). Arabidopsis NAP and PIR regulate actin-based cell morphogenesis and multiple developmental processes.Plant Physiol.1363616–3627. 10.1104/pp.104.053173
64
LiuK.LuanS. (1998). Voltage-dependent K+ channels as targets of osmosensing in guard cells.Plant Cell101957–1970.
65
MacheskyL. M.AtkinsonS. J.AmpeC.VandekerckhoveJ.PollardT. D. (1994). Purification of a cortical complex containing two unconventional actins from Acanthamoeba by affinity chromatography on profilin-agarose.J. Cell Biol.127107–115. 10.1083/jcb.127.1.107
66
MacheskyL. M.MullinsR. D.HiggsH. N.KaiserD. A.BlanchoinL.MayR. C.et al (1999). Scar, a WASp-related protein, activates nucleation of actin filaments by the Arp 2/3 complex.Proc. Natl. Acad. Sci. U.S.A.963739–3744. 10.1073/pnas.96.7.3739
67
MarchandJ.-B.KaiserD. A.PollardT. D.HiggsH. N. (2001). Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.Nat. Cell Biol.376–83. 10.1038/35050590
68
MarksM. D.WengerJ. P.GildingE.JilkR.DixonR. A. (2009). Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.Mol. Plant2803–822. 10.1093/mp/ssp037
69
MathurJ.MathurN.KernebeckB.HulskampM. (2003a). Mutations in actin-related proteins 2 and 3 affect cell shape development in Arabidopsis.Plant Cell151632–1645. 10.1105/tpc.011676
70
MathurJ.MathurN.KirikV.KernebeckB.SrinivasB. P.HulskampM. (2003b). Arabidopsis CROOKED encodes for the smallest subunit of the ARP2/3 complex and controls cell shape by region specific fine F-actin formation.Development1303137–3146. 10.1242/dev.00549
71
MenetreyJ.BahloulA.WellsA. L.YengoC. M.MorrisC. A.SweeneyH. L.et al (2005). The structure of the myosin VI motor reveals the mechanism of directionality reversal.Nature435779–785. 10.1038/nature03592
72
MichelotA.GuerinC.HuangS.IngouffM.RichardS.RodiucN.et al (2005). The formin homology 1 domain modulates the actin nucleation and bundling activity of Arabidopsis FORMIN1.Plant Cell172296–2313. 10.1105/tpc.105.030908
73
MikiH.SasakiT.TakaiY.TakenawaT. (1998a). Induction of filopodium formation by a WASP-related actin-depolymerizing protein N-WASP.Nature39193–96. 10.1038/34208
74
MikiH.SuetsuguS.TakenawaT. (1998b). WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.EMBO J.176932–6941. 10.1093/emboj/17.23.6932
75
MiyaharaA.RichensJ.StarkerC.MorieriG.SmithL.LongS.et al (2010). Conservation in function of a SCAR/WAVE component during infection thread and root hair growth in Medicago truncatula.Mol. Plant Microbe Interact.231553–1562. 10.1094/MPMI-06-10-0144
76
NebenfuhrA.GallagherL. A.DunahayT. G.FrohlickJ. A.MazurkiewiczA. M.MeehlJ. B.et al (1999). Stop-and-go movements of plant Golgi stacks are mediated by the acto-myosin system.Plant Physiol.1211127–1142. 10.1104/pp.121.4.1127
77
NolenB. J.TomasevicN.RussellA.PierceD. W.JiaZ.McCormickC. D.et al (2009). Characterization of two classes of small molecule inhibitors of Arp2/3 complex.Nature4601031–1034. 10.1038/nature08231
78
OikawaT.YamaguchiH.ItohT.KatoM.IjuinT.YamazakiD.et al (2004). PtdIns(3,4,5)P3 binding is necessary for WAVE2-induced formation of lamellipodia.Nat. Cell Biol.6420–426. 10.1038/ncb1125
79
PalinR.GeitmannA. (2012). The role of pectin in plant morphogenesis.Biosystems109397–402. 10.1016/j.biosystems.2012.04.006
80
PanchalS. C.KaiserD. A.TorresE.PollardT. D.RosenM. K. (2003). A conserved amphipathic helix in WASP/Scar proteins is essential for activation of Arp2/3 complex.Nat. Struct. Biol.10591–598. 10.1038/nsb952
81
PeremyslovV. V.ProkhevskyA. I.AvisarD.DoljaV. V. (2008). Two class XI myosins function in organelle trafficking and root hair development in Arabidopsis.Plant Physiol.1461109–1116. 10.1104/pp.107.113654
82
PerroudP.-F.QuatranoR. S. (2006). The role of ARPC4 in tip growth and alignment of the polar axis in filaments of Physcomitrella patens.Cell Motil. Cytoskeleton63162–171. 10.1002/cm.20114
83
PerroudP.-F.QuatranoR. S. (2008). BRICK1 is required for apical cell growth in filaments of the moss Physcomitrella patens but not for gametophore morphology.Plant Cell20411–422. 10.1105/tpc.107.053256
84
PollardT. D.BorisyG. G. (2003). Cellular motility driven by assembly and disassembly of actin filaments.Cell112453–465. 10.1016/S0092-8674(03)00120-X
85
QiuJ. L.JilkR.MarksM. D.SzymanskiD. B. (2002). The Arabidopsis SPIKE1 gene is required for normal cell shape control and tissue development.Plant Cell14101–118. 10.1105/tpc.010346
86
RahmanA.BanniganA.SulamanW.PechterP.BlancaflorE. B.BaskinT. I. (2007). Auxin, actin and growth of the Arabidopsis thaliana primary root.Plant J.50514–528. 10.1111/j.1365-313X.2007.03068.x
87
RobinsonR. C.TurbedskyK.KaiserD. A.MarchandJ.-B.HiggsH. N.ChoeS.et al (2001). Crystal structure of Arp 2/3 complex.Science2941679–1684. 10.1126/science.1066333
88
RodalA. A.SokolovaO.RobinsD. B.DaughertyK. M.HippenmeyerS.RiezmanH.et al (2005). Conformational changes in the Arp2/3 complex leading to actin nucleation.Nat. Struct. Mol. Biol.1226–31. 10.1038/nsmb870
89
RohatgiR.HoH. H.KirschnerM. W. (2000). Mechanism of N-WASP activation by CDC42 and phosphatidylinositol 4,5-bisphosphate.J. Cell Biol.1501299–1309. 10.1083/jcb.150.6.1299
90
RohatgiR.MaL.MikiH.LopezM.KirchhausenT.TakenawaT.et al (1999). The interaction between N-WASP and the Arp2/3 complex links Cdc42-dependent signals to actin assembly.Cell97221–231. 10.1016/S0092-8674(00)80732-1
91
RottnerK.HanischJCampelloneK. G. (2010). WASH, WHAMM and JMY: regulation of Arp2/3 complex and beyond.Trends Cell Biol.20650–661. 10.1016/j.tcb.2010.08.014
92
RottyJ. D.WuC.BearJ. E. (2013). New insights into the regulation and cellular functions of the ARP2/3 complex.Nat. Rev. Mol. Cell Biol.147–12. 10.1038/nrm3492
93
Saint-JoreC. M.EvinsJ.BatokoH.BrandizziF.MooreI.HawesC. (2002). Redistribution of membrane proteins between the Golgi apparatus and endoplasmic reticulum in plants is reversible and not dependent on cytoskeletal networks.Plant J.29661–678. 10.1046/j.0960-7412.2002.01252.x
94
SinghM. K.RenF.GiesemannT.BoscoC. D.PasternakT. P.BleinT.et al (2012). Modification of plant Rac/Rop GTPase signalling using bacterial toxin transgenes.Plant J.73314–324. 10.1111/tpj.12040
95
SmertenkoA. P.DeeksM. J.HusseyP. J. (2010). Strategies of actin reorganisation in plant cells.J. Cell Sci.1233019–3028. 10.1242/jcs.071126
96
SmithL. G.OppenheimerD. G. (2005). Spatial control of cell expansion by the plant cytoskeleton.Annu. Rev. Cell Dev. Biol.21271–295. 10.1146/annurev.cellbio.21.122303.114901
97
SparkesI.RunionsJ.HawesC.GriffingL. (2009). Movement and remodeling of the endoplasmic reticulum in nondividing cells of tobacco leaves.Plant Cell213937–3949. 10.1105/tpc.109.072249
98
StaigerC. J.SheahanM. B.KhuranaP.WangX.MccurdyD. W.BlanchoinL. (2009). Actin filament dynamics are dominated by rapid growth and severing activity in the Arabidopsis cortical array.J. Cell Biol.184269–280. 10.1083/jcb.200806185
99
SteffenA.RottnerK.EhingerJ.InnocentiM.ScitaG.WehlandJ.et al (2004). Sra-1 and Nap1 link Rac to actin assembly driving lamellipodia formation.EMBO J.23749–759. 10.1038/sj.emboj.7600084
100
StradalT. E.ScitaG. (2006). Protein complexes regulating Arp2/3-mediated actin assembly.Curr. Opin. Cell Biol.184–10. 10.1016/j.ceb.2005.12.003
101
SvitkinaT. M.BorisyG. G. (1999). Arp2/3 and actin depolymerizing factor/cofilin in dendritic organization and treadmilling of actin filament array in lamellipodia.J. Cell Biol.1451009–1026. 10.1083/jcb.145.5.1009
102
SzymanskiD. B. (2005). Breaking the WAVE complex: the point of Arabidopsis trichomes.Curr. Opin. Plant Biol.8103–112. 10.1016/j.pbi.2004.11.004
103
SzymanskiD. B.CosgroveD. J. (2009). Dynamic coordination of cytoskeletal and cell wall systems during plant cell morphogenesis.Curr. Biol.19R800–R811. 10.1016/j.cub.2009.07.056
104
SzymanskiD. B.MarksM. D.WickS. M. (1999). Organized F-actin is essential for normal trichome morphogenesis in Arabidopsis.Plant Cell112331–2347. 10.1105/tpc.11.12.2331
105
TominagaM.KojimaH.YokotaE.OriiH.NakamoriR.KatayamaE.et al (2003). Higher plant myosin XI moves processively on actin with 35~nm steps at high velocity.EMBO J.221263–1272. 10.1093/emboj/cdg130
106
UedaH.YokotaE.KutsunaN.ShimadaT.TamuraK.ShimmenT.et al (2010). Myosin-dependent endoplasmic reticulum motility and F-actin organization in plant cells.Proc. Natl. Acad. Sci. U.S.A.1076894–6899. 10.1073/pnas.0911482107
107
UhrigJ. F.MutondoM.ZimmermannI.DeeksM. J.MacheskyL. M.ThomasP.et al (2007). The role of Arabidopsis SCAR genes in ARP2-ARP3-dependent cell morphogenesis.Development134967–977. 10.1242/dev.02792
108
UraS.PollittA. Y.VeltmanD. M.MorriceN. A.MacheskyL. M.InsallR. H. (2012). Pseudopod growth and evolution during cell movement is controlled through SCAR/WAVE dephosphorylation.Curr. Biol.22553–561. 10.1016/j.cub.2012.02.020
109
Van GisbergenP. A.LiM.WuS. Z.BezanillaM. (2012). Class II formin targeting to the cell cortex by binding PI(3,5)P(2) is essential for polarized growth.J. Cell Biol.198235–250. 10.1083/jcb.201112085
110
VeltmanD. M.InsallR. H. (2010). WASP family proteins: their evolution and its physiological implications.Mol. Biol. Cell212880–2893. 10.1091/mbc.E10-04-0372
111
WeinerO. D.RentelM. C.OttA.BrownG. E.JedrychowskiM.YaffeeM. B.et al (2006). Hem-1 complexes are essential for Rac activation, actin polymerization and myosin regulation during neutrophil chemotaxis.PLoS Biol.4:e38. 10.1371/journal.pbio.0040038
112
WelchM. D.MullinsR. D. (2002). Cellular control of actin nucleation.Annu. Rev. Cell Dev. Biol.18247–288. 10.1146/annurev.cellbio.18.040202.112133
113
WellsA. L.LinA. W.ChenL. Q.SaferD.CainS. M.HassonT.et al (1999). Myosin VI is an actin-based motor that moves backwards.Nature401505–508. 10.1038/46835
114
WinterD.LechlerT.LiR. (1999). Activation of the yeast Arp 2/3 complex by Bee1p, a WASP-family protein.Curr. Biol.501–504. 10.1016/S0960-9822(99)80218-8
115
XuT.WenM.NagawaS.FuY.ChenJ. G.WuM. J.et al (2010). Cell surface- and rho GTPase-based auxin signaling controls cellular interdigitation in Arabidopsis.Cell14399–110. 10.1016/j.cell.2010.09.003
116
YalovskyS.BlochD.SorekN.KostB. (2008). Regulation of membrane trafficking, cytoskeleton dynamics, and cell polarity by ROP/RAC GTPases.Plant Physiol.1471527–1543. 10.1104/pp.108.122150
117
YararD.ToW.AboA.WelchM. (1999). The Wiskott-Aldrich syndrome protein directs actin-based motility by stimulating actin nucleation with the Arp 2/3 complex.Curr. Biol.9555–558. 10.1016/S0960-9822(99)80243-7
118
YokotaK.FukaiE.MadsenL. H.JurkiewiczA.RuedaP.RadutoiuS.et al (2009). Rearrangement of actin cytoskeleton mediates invasion of Lotus japonicus roots by Mesorhizobium loti.Plant Cell21267–284. 10.1105/tpc.108.063693
119
ZhangC.KotchoniS. O.SamuelsA. L.SzymanskiD. B. (2010). SPIKE1 signals originate from and assemble specialized domains of the endoplasmic reticulum.Curr. Biol.202144–2149. 10.1016/j.cub.2010.11.016
120
ZhangC.MalleryE.ReaganS.BoykoV. P.KotchoniS. O.SzymanskiD. B. (2013). The endoplasmic reticulum is a reservoir for WAVE/SCAR regulatory complex signaling in the Arabidopsis leaf.Plant Physiol.10.1104/pp.113.217422 [Epub ahead of print].
121
ZhangC.MalleryE. L.SchlueterJ.HuangS.FanY.BrankleS.et al (2008). Arabidopsis SCARs function interchangeably to meet actin-related protein 2/3 activation thresholds during morphogenesis.Plant Cell20995–1011. 10.1105/tpc.107.055350
122
ZhangX.DyachokJ.KrishnakumarS.SmithL. G.OppenheimerD. G. (2005). IRREGULAR TRICHOME BRANCH1 in Arabidopsis encodes a plant homolog of the actin-related protein2/3 complex activator Scar/WAVE that regulates actin and microtubule organization.Plant Cell172314–2326. 10.1105/tpc.104.028670
Summary
Keywords
SCAR, WAVE, ARP2/3, actin, ROP, Arabidopsis
Citation
Yanagisawa M, Zhang C and Szymanski DB (2013) ARP2/3-dependent growth in the plant kingdom: SCARs for life. Front. Plant Sci. 4:166. doi: 10.3389/fpls.2013.00166
Received
09 March 2013
Accepted
12 May 2013
Published
21 June 2013
Volume
4 - 2013
Edited by
Marisa Otegui, University of Wisconsin at Madison, USA
Reviewed by
Viktor Zarsky, Charles University, Czech Republic; Elison B. Blancaflor, The Samuel Roberts Noble Foundation, USA
Copyright
© Yanagisawa, Zhang and Szymanski.
This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits use, distribution and reproduction in other forums, provided the original authors and source are credited and subject to any copyright notices concerning any third-party graphics etc.
*Correspondence: Daniel B. Szymanski, Department of Agronomy, Purdue University, 1150 Lilly Hall of Life Sciences, West Lafayette, IN 47907-1150, USA e-mail: dszyman@purdue.edu
This article was submitted to Frontiers in Plant Cell Biology, a specialty of Frontiers in Plant Science.
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.