Abstract
Plant cyclic peptides (CPs) are a large group of small molecule metabolites found in a wide variety of plants, including traditional Chinese medicinal plants. However, the majority of plant CPs have not been studied for their biosynthetic mechanisms, including heterophyllin B (HB), which is one of the characteristic chemical components of Pseudostellaria heterophylla. Here, we screened the precursor gene (prePhHB) of HB in P. heterophylla and functionally identified its correctness in vivo and in vitro. First, we developed a new method to screen the precursors of HB from 16 candidate linear peptides. According to transcriptome sequencing data, we cloned the genes that encoded the HB precursor peptides and confirmed that the prePhHB-encoded precursor peptide could enzymatically synthesize HB. Next, we generated the transgenic tobacco that expressed prePhHB, and the results showed that HB was detected in transgenic tobacco. Moreover, we revealed that prePhHB gene expression is positively correlated with HB accumulation in P. heterophylla. Mutations in the prePhHB gene may influence the accumulation of HB in P. heterophylla. These results suggest that HB is ribosomally synthesized and posttranslationally modified peptide (RiPP) derived from the precursor gene prePhHB-encoded precursor peptide, and the core peptide sequence of HB is IFGGLPPP in P. heterophylla. This study developed a new idea for the rapid identification of Caryophyllaceae-type CP precursor peptides via RNA-sequencing data mining.
Introduction
Bioactive peptides have a wide range of physiological functions, including regulating signal transmission, promoting enzyme synthesis, and resisting virus invasion (; ). Cyclic peptides (CPs) are a special type of active peptides that have a circular molecule structure (; ). CPs are distributed in a very wide range of taxa, including plants, bacteria, fungi, and animals (; ; ). They have a diverse range of biological activities, including anti-inflammation, antibacterial, and anti-HIV activities (; ; ). In addition, CP compounds can form tubular structures and act as membrane ion transferring carriers (). Plant CPs are a large group of small molecule metabolites, typically with 2–37 protein and non-protein amino acids (mainly L-amino acids), which are formed mainly by the peptidic bonds and isolated from the stem barks, leaves, seeds, and roots of a wide variety of higher plants (; ). So far, more than 450 plant CPs have been discovered from 26 families of higher plants; they are most commonly found in the Caryophyllaceae, Rhamnaceae, and Violaceae families (; ; ).
Several traditional Chinese medicinal plants contain abundant plant CPs, including Pseudostellaria heterophylla (Miq.) Pax (; ). P. heterophylla is an herbaceous perennial, a Caryophyllaceae species known as Taizishen (). Its dried tuberous root is named Pseudostellariae radix and is a traditional Chinese medicine with high pharmacodynamic value. It can be used to treat spleen deficiency, anorexia, weakness after illness, and spontaneous perspiration symptoms because of its various active components, including saponins, polysaccharides, and cyclopeptides (; ; ). Heterophyllin B (HB) is one of the characteristic chemical components of P. heterophylla and is used as the quality control index for evaluating Pseudostellariae radix in the Chinese pharmacopoeia (2010 edition, Volume I) (). HB is a cyclic octapeptide with a single ring formed with peptide bonds and eight L-amino acids, which belongs to the Caryophyllaceae-like CPs and is abundant in the tuberous roots of P. heterophylla (). Studies have shown that HB is effectively suppressed the adhesion and invasion of the human esophageal carcinoma cells and ameliorates lipopolysaccharide-induced inflammation and oxidative stress in macrophages by mediating the PI3K/AKT/β-catenin pathways (; ). However, the mechanism for the biosynthesis of HB is still unclear.
Fortunately, recent studies have found that CPs are generated through two biosynthetic routes, which involve either non-ribosomal peptide synthases or ribosome-dependent production of precursor peptides. In one route, ribosomes are participated in the initial ordering of mRNA-encoded amino acids to form a linear peptide precursor (; ; ; ). In another route, the amino acids are ordered without direct ribosome involvement, via non-ribosomal peptide synthetases (). Accumulated evidence suggests that ribosome-dependent biosynthesis of CPs were widespread in animals and fungi (; ; ). Moreover, ribosome-dependent biosynthesis of CPs also have been reported in plant. Segetalins, belonging to Caryophyllaceae-like CPs, have been demonstrated to be formed by ribosome-dependent linear peptides (). It has also been reported that a small amount of cyclized product (HB) was produced when linear peptide NH2-Gly1-Gly2-Leu-Pro-Pro-Pro-Ile-Phe-COOH of HB was incubated with crude enzyme extracted from P. heterophylla (; ). In addition, plant genomes do not encode nonribosomal peptide synthetases (NRPSs) (). Therefore, we hypothesized that HB is biosynthesized from ribosome-derived linear precursors.
In the present study, we developed a new approach to screen the precursor genes (prePhHB) of HB in P. heterophylla. It was demonstrated in vivo and in vitro that linear peptides encoded by prePhHB could eventually synthesize HB. Moreover, it is probable that mutations in the prePhHB gene affect HB synthesis in P. heterophylla.
Materials and Methods
Plant Materials
Sample collection was performed for P. heterophylla cultivated in five areas, including Jiangsu Province, Fujian Province, Anhui Province, Guizhou Province, and Shandong Province, China. Among them, three samples were collected from per cultivated area. These samples were used to compare the content of HB. All sample information is shown in Table S1.
Regarding transplantation, P. heterophylla from the above four areas (the specific location is shown in Table S2) were planted in Guizhou (107°55′31″N, 27°8′24″E) for 1 year. After that, these plants of P. heterophylla were used for gene sequence analysis and HB analysis.
Wild-type tobacco seeds were surface-sterilized, planted on Murashige and Skoog (MS) medium, and solidified with 3% (w/v) sucrose and 0.7% (w/v) agar. Six-week-old tobacco plants, which were grown in an intelligent artificial climate box under long-day conditions (16 h light/8 h dark) at 25°C, were used for identification of the prePhHB gene.
Character Analysis
Sampling was performed according to the quartering method. The weight of single fresh tuberous root of 138 P. heterophylla samples was determined through an electronic balance. Twenty tuberous roots were measured for each sample. The weight accuracy is 0.01 g.
High-Performance Liquid Chromatography (HPLC) Analysis
All samples were dried at 60°C up to dryness via the oven-drying method and crushed to a mediate powder. Next, 0.5 g of the mediate powder in 25 ml of ethanol was ultrasonicated for 45 min and filtered. Next, 20 ml of the filtrate was evaporated to dryness; the residue was dissolved in 5 ml of ethanol, which was passed through 0.45-µm syringe filters to obtain the test solution and analyzed via HPLC. HB standard (purity ≥ 95%) was obtained from Laboratory of Phytochemistry, Kunming Institute of Botany, Chinese Academy of Sciences (Kunming, China).
HPLC analysis of HB was performed on a Shimadzu LC-20AD Prominence HPLC System (Shimadzu, Japan) that consisted of a LC-20AD Pump, a SIL-20A Autosampler, an SPD-M20A DAD, and a CTO-20AC column heater, using a Pntulips™ QS-C18 column (4.6 × 250 mm, 5-μm particle size). The mobile phase was acetonitrile: H2O (31: 69, v/v). The flow rate was kept at 1.0 ml/min, and the eluate was injected onto a DAD detector. The injection volume of the test solution was 20 µl, and the injection volume of HB standard was 10 µl. The column temperature was maintained at 30°C, and the wavelength of the detector was set at 192 nm. HB was identified via its retention time and spectral data compared with those of HB standard, and the content of HB in the test solution was calculated via the one-point external standard method.
Total RNA Extraction and cDNA Synthesis
Total RNA was extracted from each sample using a RNAiso Plus Kit (TaKaRa, Japan) according to the manufacturer’s instructions. RNA integrity was determined using 1.5% agarose gel; RNA concentration and purity were assessed on a Nanodrop 2000 spectrophotometer (Thermo Fisher Scientific, USA). Next, 800 ng of total RNA from each sample was reverse-transcribed into single-stranded cDNA using a M-MLV Reverse Transcriptase Kit (TaKaRa, Japan) and oligo (dT)15 primer, following the manufacturer’s instructions. The first-strand cDNA was diluted to a final concentration of 80 ng·μl−1 and used as templates for PCR and real-time quantitative polymerase chain reaction (RT-qPCR).
DNA Extraction
DNA was extracted from the kanamycin-resistant tobacco plants using the modified CTAB method (). And the presence of the prePhHB gene was demonstrated via PCR analysis.
Gene Screening
Considering that the cyclization pattern of Caryophyllaceae-like CPs is head-to-tail, their nomenclature is written as a one-line text formula, including the prefix “cyclo,” a hyphen and a sequence of amino acids in a particular order (; ). In the case of HB, being a cyclic octapeptide, 16 possible symbols after ring-opening can be used to write its single line formula (Table 1). They were screened for exact matches from six-frame translations of the P. heterophylla RNA-sequencing (RNA-seq) database (). Finally, similarity analysis was performed between the predicted amino acid sequences of the retrieved cDNAs and the amino acid sequences of known CP precursor ().
Table 1
| No. | Amino acid sequences | Number of unigene | Unigene number | No. | Amino acid sequences | Number of unigene | Unigene number |
|---|---|---|---|---|---|---|---|
| 1 | IFGGLPPP | 1 | c57752_g2 | 9 | PPPLGGFI | 0 | 0 |
| 2 | FGGLPPPI | 0 | 0 | 10 | IPPPLGGF | 0 | 0 |
| 3 | GGLPPPIF | 0 | 0 | 11 | FIPPPLGG | 0 | 0 |
| 4 | GLPPPIFG | 0 | 0 | 12 | GFIPPPLG | 0 | 0 |
| 5 | LPPPIFGG | 0 | 0 | 13 | GGFIPPPL | 0 | 0 |
| 6 | PPPIFGGL | 0 | 0 | 14 | LGGFIPPP | 0 | 0 |
| 7 | PPIFGGLP | 0 | 0 | 15 | PLGGFIPP | 0 | 0 |
| 8 | PIFGGLPP | 0 | 0 | 16 | PPLGGFIP | 0 | 0 |
Sixteen possible amino acid sequences after the ring-opening of the cyclic octapeptide HB; these were screened for exact matches from six-frame translations of the P. heterophylla RNA-seq database.
Isolation of the Full-Length cDNA of prePhHB
A pair of primers, prePhHB-F/prePhHB-R (Table 2), were designed to amplify the unigene c57752_g2 from P. heterophylla (“GZSB”) for sequence verification. The amplified PCR products were directly cloned into pMD19-T vector (TaKaRa, Japan) and then transformed into Escherichia coli DH5α competent cells (Tiangen, China) according to the manufacturer’s instructions. Putative recombinant clones were screened via PCR using M13 primers (Table 2), and the positive clones were further confirmed via Sanger sequencing at Nanjing GenScript Biotech Co., Ltd. (Nanjing, China).
Table 2
| Primer name | Sequence (5′→3′) |
|---|---|
| T15 | TTTTTTTTTTTTTTT |
| prePhHB-F | ATGTCTACTATTTCAGCC |
| prePhHB-R | CTTACACCATGAGGAAA |
| prePhHB-5 | AGGAGGAGGAAGACCCCCAAAAAT |
| prePhHB-3 | ATTTTTGGGGGTCTTCCTCCTCCT |
| Long primer | CTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT |
| CDS-prePhHB-F | AGTATTTTTGGGGGTCTTCCTCCTC |
| CDS-prePhHB-R | TACACAACACCATAAAAGCCCAACG |
| prePhHB-S | CGCGGATCCATGTCTACTATTTCAGCCATCCAC |
| prePhHB-A | CCGGAATTCTTACACCATGAGGGAAATATCATC |
| prePhHB-qF | AGCCGAGTATTTTTGGGGGTCTTCC |
| prePhHB-qR | CATAAAGGCCCAACGGTGACGGAC |
| PhACT2-F | CTCCATACCGATAAATGAAGGC |
| PhACT2-R | CACTGTTCCAATCTATGAGGGTTA |
| QX-F | ACGACTCAATGACAAGAAGAA |
| QX-R | CCGGCGGTAAGGATCTGA |
| Actin-qF | CAGCAAAGACCAGCTCATCC |
| Actin-qR | AGCAGCTTCCATTCCGATCA |
| M13-R | CAGGAAACAGCTATGAC |
| M13-F | GTAAAACGACGGCCAG |
Primers used to isolate HB precursor genes from P. Heterophylla, M13-R and M13-F.
After DNA sequencing analysis, two RACE specific primers, prePhHB-5 and prePhHB-3 (Table 2), were designed based on the 108-bp singlet to clone the 5’- and 3’- ends of the prePhHB cDNA via rapid amplification of cDNA ends (RACE) using the SMARTer® RACE 5’/3’ Kit (TaKaRa, Japan), according to the manufacturer’s instructions. Other experimental methods are shown above.
Isolation of the Coding Sequence of prePhHB
To determine whether the newly identified prePhHB exhibits sequence differences in the differently cultivated P. heterophylla, one pair of specific primers, CDS-prePhHB-F/CDS-prePhHB-R (Table 2), was designed for specific combination with the prePhHB sequence which the core peptide of HB. The cloning procedure used was the same as described above. Lastly, positive clones (named prePhHB-JSJR, prePhHB-AHXZ, prePhHB-GZSB, and prePhHB-FJZR, respectively) were picked out and sent to GenScript (Nanjing, China) and Sangon Biotech (Shanghai, China) for sequencing.
Phylogenetic Analysis
Multiple alignments of amino acid sequences were performed using the ClustalX (version 2.1) software, and then, the neighbor-joining phylogenetic tree was constructed via using MEGA 6.0 software. Branch points were assessed by bootstrap analysis with 1,000 replications.
Enzymic Synthesis of HB In Vitro
The linear precursor of HB encoded by prePhHB gene was synthesized using the FlexPeptide™ technology by GenScript (Nanjing, China). Five grams of phloem of the tuberous roots of “GZSB” were manually homogenized with a ceramic pestle in a 100-mm ceramic mortar in 4 × 5 ml 20 mM Tris-HCl (pH 8.0) on ice and transferred to a 50-ml sterile microcentrifuge tube. Next, 2 ml 20 mM Tris-HCl (pH 8.0) solution was used to clean the mortar and was transferred to the 50-ml sterile centrifuge tube. Shaking and extraction were performed at 100 rpm for 30 min, followed by centrifugation at 8,000 rpm for 30 min. The supernatant was centrifuged using 100-kDa ultrafiltration centrifuge tube and then using 30-kDa ultrafiltration centrifugal tube. The concentrate collected was then added with an appropriate amount of 1 M Tris-HCl (pH 8.5), shaken, and centrifuged. This crude extract supernatant (i.e., crude enzymes) was used for in vitro functional assays of linear precursor of HB. The crude enzymes were identified via SDS-PAGE and measured using a BCA Protein Assay Kit (CWBIO, China).
An in vitro functional assay for linear precursor of HB was performed in a 2-ml reaction mixture that contained 20 mM Tris-HCl (pH 8.5), 100 mM NaCl, 5 mM DTT, 0.2 mg BSA, and 25 μg·ml−1 linear precursor of HB. The reaction was initiated by the addition of 1 mg crude enzyme. Five different reaction times and the temperature range of 25 to 37°C were screened to determine the optimum time and temperature condition for the reaction. At the indicated times, 2 ml of reaction mixture was removed and stopped via placing reactions in dry ice. The samples were then filtered using 0.22-μm filters, and a 2-ml filtered sample was analyzed via HPLC (see above).
Construction of the prePhHB Expression Vector and Genetic Transformation
The full-length coding sequence of prePhHB with specific restriction enzyme sites (Table 2) was cloned into the pLGNL vector at the BamH I and EcoR I sites to obtain the transformation vector pLGNL-prePhHB. Therefore, a fragment of prePhHB was driven by the cauliflower mosaic virus 35S promoter. All constructs were verified via DNA sequencing.
After sequence verification, the resultant plasmid (pLGNL-prePhHB) was transformed into the Agrobacterium tumefaciens strain LBA4404 competent cells (Weidi, China) using the freeze-thaw method. And then transferred into tobacco plants viaAgrobacterium-mediated transformation following the protocol described by Pathi (). Next, transgenic lines were selected on a selective medium containing 50 mg/L kanamycin and 100 mg/L cefotaxime sodium salt and transferred to soil and grown until seed harvest.
Ultra-High-Performance Liquid Chromatography–Mass Spectrometry (UHPLC-MS/MS) Analysis
The roots, stems, and leaves of transgenic lines (L1, L22, and L25) along with WT (wild-type tobacco, non-transgenic) plants were dried to dryness at 60°C via the oven-drying method and then crushed to mediate powder. Next, 2 g of the mediate powder in 50 ml of ethanol was ultrasonicated for 45 min and filtered. Then, 25 ml of the filtrate was evaporated to dryness. The residue was dissolved in 5 ml of ethanol and filtered through a 0.22-µm syringe filter into a sample vial for subsequent analysis.
Thermo Scientific UHPLC Accela 1250 System was connected to a Thermo Scientific TSQ Quantum Access MAX Mass Spectrometer (San Jose, CA, USA) to perform the analysis. The chromatographic separation was performed using a Thermo Scientific UHPLC Accela 1250 System consisting of an Accela 1250 PDA Detector, an Accela HTC PAL Autosampler, and an Accela 1250 pump. The extract was applied to a Hypersil GOLD column (50 mm × 2.1 mm, 1.9 μm) maintained at 45°C. The mobile phase was acetonitrile: 0.1% formic acid/water (30:70, v/v). The injection volume was 5 µl, and the flow rate was kept at 0.2 ml/min.
Mass spectrometric detection was carried out on a Thermo Scientific TSQ Quantum Access MAX Mass Spectrometer, which was equipped with an electrospray ionization (ESI) interface operating in positive ion mode. The parameters were set as follows: the pressure of nebulizing gas (N2) was set at 30 and 5 arbitrary units (Arb), respectively; capillary temperature, 350°C; nebulizing temperature, 500°C; spray voltage, 2500 V; and scanning frequency, 0.1 s. The selected reaction monitoring (SRM) transitions were monitored at m/z 69.52 → 183.10. Data acquisition was performed on the LCQUAN™ quantitation software.
RT-qPCR
RT-qPCR primers are listed in Table 2. RT-qPCR was performed using a SYBR® Premix Ex Taq™ II (Tli RNaseH Plus) (TaKaRa, Japan) with an Applied Biosystems 7500 Real-Time PCR System (Applied Biosystems, USA). All reactions were performed in three biological replicates per sample with three technical replicates each. Relative expression of prePhHB in each sample was calculated using the 2−ΔCT method (). The PhACT2 (GenBank accession number KT363848) and ACTIN (GenBank accession number AY179605) genes were used as housekeeping genes, respectively.
Statistical Analysis
All results are expressed as the means ± standard errors of mean (SEM). Statistical analysis and graphs were performed using GraphPad Prism (version 7.0). Potential differences between the mean values were evaluated using a one-way analysis of variance (ANOVA) followed by the least significant difference (LSD) test for post hoc comparisons when equal variances were assumed. P < 0.05 was considered as statistically significant difference.
Results
The Content of HB in P. Heterophylla Is Different in Five Planting Regions
At present, in the traditional Chinese medicine market, the cultivated P. heterophylla are mainly produced from five provinces of China, including Shandong, Jiangsu, Anhui, Guizhou, and Fujian. We collected the samples of P. heterophylla from these provinces and measured the fresh weight of single tuberous root. No significant differences were found when we compared the characters of flowers, leaves, and tuberous roots of P. heterophylla (Figure 1A). However, the results showed that the fresh weight of tuberous roots also had no statistically significant difference in these P. heterophylla samples (Figure 1B).
Figure 1
HB is one of the characteristic chemical components of P. heterophylla, which is a cyclic octapeptide with a single ring formed with peptide bonds and eight L-amino acids (Figure 1D). We further detected the HB content in tuberous roots of cultivated P. heterophylla from different areas using HPLC (Figure 1E). Surprisingly, even though under the same detection conditions, HB was not detected in the cultivated P. heterophylla from Fujian province (Figures 1C, E). This result indicates that the accumulation of HB in P. heterophylla has a distinct regionality. We also speculated that this regionality may be related to the ecological environment and the germplasm genetic factors of P. heterophylla.
To eliminate the influence of environmental factors on the accumulation of HB in P. heterophylla, we introduced P. heterophylla seedling from these four provinces (Fujian, Jiangsu, Anhui, and Guizhou) into the same environment (Table S2). We also detected the content of HB in tuberous roots of P. heterophylla. The results were similar to those found above; it is suggested that HB content differences may be mainly related to the germplasm genetic factors.
Screening of the prePhHB Gene-Encoding Linear Precursor of HB From P. Heterophylla
To obtain the gene encoding the linear precursor of HB, we opened the ring of HB to 16 possible linear peptides. These linear peptides were matched to amino acid sequences which translated from the P. heterophylla RNA-seq database via six-frame translations (Figure 2A). The results showed that the amino acid sequence no. 1 was matched to one unigene (i.e., c57752_g2) (Table 1). To further identify the unigene c57752_g2, we used the putative amino acid sequence of the unigene (c57752_g2) to perform a homologous comparison with the Caryophyllaceae-like CP precursors of Saponaria vaccaria and Dianthus caryophyllus (accession numbers AW697819 and CF259478). The results from multiple amino acid sequence alignment and amino acid composition analysis showed that there is a high similarity between the 12 amino acid sequences (Figure 2B). These results suggest that the unigene c57752_g2 may be a precursor gene encoding the linear precursor of HB, which is named perPhHB.
Figure 2
Based on the known fragment of perPhHB, specific primers for RT-PCR, 5′-RACE, and 3′-RACE were designed to isolate the full-length perPhHB cDNA sequence from P. heterophylla. The full-length cDNA (386 bp) contained a 108-bp coding sequence, which encodes a putative precursor of HB with 35 amino acids, a 63 bp 5′-untranslated region (UTR), and a 152 bp 3′-UTR with an AATAAAA frame and a 28-bp poly (A) tail (Figure 2C).
A neighbor-joining phylogenetic tree was constructed via the MEGA 6.0 software with 1,000 bootstrap replications, which based on alignment of the amino acid sequences of prePhHB and other amino acid sequences that encode the Caryophyllaceae-like CP precursors. Phylogenetic analysis showed that the 12 amino acid sequences were clustered into two branches: one branch was class I CPs of Saponaria vaccaria and CPs of Dianthus caryophyllus; another branch was included class II CPs of Saponaria vaccaria and HB of P. heterophylla (Figure 2D). Thus, prePhHB is likely the biosynthetic precursor of HB.
prePhHB Gene Expression Is Positively Correlated With HB Accumulation in P. Heterophylla
To preliminarily confirm the function of prePhHB, the expression levels of HB synthesis related genes were analyzed using FPKM (fragments per kilobase of exon model per million mapped reads) (Figure 3A) (). The results showed that the expression level of the prePhHB gene was highest among these related genes in the tuberous root. Furthermore, the prePhHB expression level in phloem of tuberous root surpassed xylem. We measured the HB content of four tissues of P. heterophylla and analyzed the correlation between prePhHB gene expression level and HB content. The results revealed that the HB content had a significant difference in these tissues (Figure 3B). The results of correlation analysis revealed that prePhHB expression level was positively correlated with the HB content in P. heterophylla (Figure 3C). Accordingly, the level of prePhHB transcription was completely in accordance with the HB accumulation pattern in the different organs of P. heterophylla, which further indicated that prePhHB is the precursor gene of HB.
Figure 3
HB Is Derived From prePhHB-Encoded Linear Peptide in Enzymatic Conditions
To investigate whether the prePhHB-encoded linear peptide could be converted to HB, an enzyme-catalyzed reaction was tested in vitro (Figure 4A). As mentioned above, compared to other tissues of P. heterophylla, prePhHB was much more expressed in phloem of the tuberous roots; therefore, we hypothesized that the enzymes catalyzing the cyclization of the prePhHB-encoded linear peptides are mainly accumulated in developing phloem of the tuberous roots of P. heterophylla. Nevertheless, these enzymes and their corresponding functions have not been isolated and identified, respectively. Therefore, crude enzymes extracted from the phloem of tuberous roots of P. heterophylla were used in this experiment. The prePhHB-encoded linear peptide (MSTISAIHIMKPSIFGGLPPPSQELINGDDISLMV) was synthesized, and a purity of more than 86.71% and an MW of 1237.75 was confirmed via HPLC and LC-MS (Figure S1). The prePhHB-encoded linear peptide was catalyzed by crude enzymes for gradient time or temperature. The reaction products were also assayed for HB content via HPLC (Figure S2). The results showed that the content of HB was gradually increased with elevation of the reaction temperature, but it was gradually decreased with an increase of the reaction time. However, under different conditions, it is particularly noteworthy that the amount of produced cyclized products (HB) was significantly higher when compared with the control group (p < 0.001) (Figures 4B, C).
Figure 4

Enzymatic verification of the conversion of preheterophyllin B to HB in vitro. (A) Schematic diagram in which crude enzymes are combined with polypeptide in an aqueous environment to convert the substrate to HB through a series of reactions. (B and C) Quantitative analysis of the HB is formed by polypeptides under the action of crude enzymes in vitro, bars represent means ± SEM of four independent experiments, and asterisks represent significant difference between control and polypeptide, with a one-way ANOVA test (***p < 0.001).
Expression of the prePhHB in Tobacco Resulted in HB Generation
To further identify the products of prePhHB, the prePhHB gene was introduced into tobacco using Agrobacterium-mediated transformation. The full-length coding sequence of prePhHB was cloned into the pLGNL expression vector and was genetically transformed in tobacco leaves. After co-cultivation for 3 days in MS medium, the plants were transferred to a selection medium with 100 mg/L Kan and 500 mg/L Cef. The kanamycin-resistant plants and PCR positive plants were transferred to the rooting medium (Figures S3 and S4A). Next, the plants with complete root development were selected and transferred to a greenhouse for further growth. Total RNA was extracted from the stems, leaves, roots of transgenic lines, and WT plants and subjected to RT-PCR using specific primers of prePhHB. As expected, expression of prePhHB was detected in the stems, leaves, and roots of transgenic plants but was not detected in WT tobacco (Figures 5A and S4B).
Figure 5

Recombinant expression of prePhHB in tobacco leaves enables HB production. (A) Quantification of the RT-PCR analysis results of the Figure (S4B) using ImageJ software. All analyses were performed with three biological replicates, and bars represent means ± SEM. (B) Total ion chromatograms (TIC) of the extracts of wild-type and transgenic tobacco are shown. (i) HB standard test via UPLC-MS/MS; (ii) no HB for WT tobacco was detected; (iii) expression of prePhHB leads to accumulation of HB (RT = 4.12 min). (C) Production of HB in transformed tobacco generated using Agrobacteriumtumefaciens strain harboring pLGNL-prePhHB or WT tobacco. HB was determined by UHPLC-MS/MS. N.D. is not detected, and data are the means ± SEM of three biological replicates.
To determine whether the expression of prePhHB enables HB formation, the metabolites were extracted and subjected to UPLC-MS/MS analysis. Based on UPLC-MS/MS, the roots, stems, and leaves of transgenic lines (L1, L22 and L25) were found to contain HB, while no HB was detected in the roots, stems, and leaves of WT tobacco (Figure 5B). Moreover, the HB content in L22 roots was the highest, up to 0.044% (Figure 5C). Thus, HB is derived from the precursor gene prePhHB.
Mutations in the prePhHB Gene May Affect the Accumulation of HB in “FJZR”
To investigate the mechanisms underlying regional difference in the HB content in P. heterophylla from different regions, we transplanted P. heterophylla from different regions (Jiangsu, Anhui, Fujian, Guizhou) to the same place (Guizhou) for 1 year to eliminate environmental factors. HB was identified and quantified using HPLC-DAD. We found that there were significant differences in the HB content among four provenances (“JSJR”, “FJZR”, “AHXZ”, and “GZSB”). However, HB was not detected in the tuberous roots of “FJZR” (Figure 6A). The expression level of prePhHB was evaluated via RT-qPCR. As shown in Figure 6B, the prePhHB was low expression in “FJZR”, which is consistent with the change in HB content.
Figure 6

Mutations of prePhHB may result in accumulation of HB in “FJZR”. (A) HB was identified and quantified using HPLC-DAD, and N.D. is not detected. Bars represent the mean values ± SEM of three biological replicates. (B) The expression pattern of prePhHB in tuberous roots of P. heterophylla that were originated in different regions: “JSJR”, “FJZR”, “AHXZ”, and “GZSB”, respectively, using RT-qPCR. The values are the means ± SEM of three biological replicates. (C) The sequence alignment of prePhHB among P.heterophylla from the “JSJR”, “FJZR”, “AHXZ”, and “GZSB”. Mutation sites were highlighted by striking color. Red areas represent insertion mutation, and purple areas represent deletion mutation.
To further explore the molecular mechanism of low expression of the prePhHB in “FJZR”, we cloned and sequenced the full-length coding sequence of prePhHB from “JSJR”, “FJZR”, “AHXZ”, and “GZSB”. The DNA sequencing results showed that two mutations were detected in “FJZR” in addition to the normal prePhHB-FJZR1 gene of the prePhHB. Concretely, three pairs of bases were inserted into 54 to 56 sites in the ORF of the prePhHB-FJZR2, which resulted in the increase of 1 amino acid residue (Phe). Meanwhile, three pairs of bases were deleted at 61 to 63 in the ORF of the prePhHB-FJZR3, which resulted in the deletion of one amino acid residue (Pro) (Figure 6C).
Discussion
Caryophyllaceae-type CPs have been reported from Caryophyllaceae family, Rhamnaceae family, and other eight families (
From the transcriptome data, we found that only 1 (IFGGLPPP) of the 16 amino acid sequences was perfectly matched. The deduced protein sequence of this sequence (prePhHB) shows high similarity to Caryophyllaceae-like CP precursor peptides. Moreover, in the phylogenetic tree, the prePhHB is closely related to the precursor peptides of segetalin F and segetalin J of Saponaria vaccaria. These results suggest that the prePhHB may be the precursor peptide of HB. Most interestingly, prePhHB contained a core peptide (IFGGLPPP) motif. However, this is different from previous reports that the core peptide of HB may be GGLPPPIF (
Besides, we discovered the existence of significant differences in HB content in cultivated P. heterophylla from different areas. The content of HB was the highest in the Jiangsu P. heterophylla; however, almost no HB was detected in the Fujian P. heterophylla. Previous studies have also shown that there are obvious differences in the quality of different cultivated P. heterophylla from different fields (
Given this interesting phenomena, under the premise of eliminating the ecological environment and cultivation technology, we established correlations between prePhHB expression patterns and HB distributions in “JSJR”, ‘FJZR”, “AHXZ”, and “GZSB”. Interestingly, the relative expression level of prePhHB among “JSJR”, “AHXZ”, and “GZSB” that the differences among cultivars were very high but not much different in HB content. It is suggested that the formation and accumulation of HB in P. heterophylla may be influenced by the precursor gene prePhHB, the key enzyme genes of biosynthesis, and other regulatory genes. More interestingly, we found that there are two mutants of prePhHB in “FJZR,” prePhHB-FJZR2 and prePhHB-FJZR3, respectively, as well as normal prePhHB-FJZR1, but HB has not been detected. This result can be explained as follows: although prePhHB-FJZR1 contains no mutation, the relative expression of the prePhHB-FJZR1 gene is less than 0.002, so the amount of HB formed may be very small, which is less than the minimum detection limit of HPLC analysis. And under the chromatographic conditions of this study, the minimum detection limit of HB was 0.673 µg/ml. Moreover, Caryophyllaceae-like CPs are head-to-tail-cyclized plant CPs (
Overall, our results suggest that HB is RiPP derived from the precursor gene prePhHB-encoded precursor peptide, and the core peptide sequence of HB is IFGGLPPP in P. heterophylla. These findings developed a new idea for the rapid identification of Caryophyllaceae-type CP precursor peptides via RNA-seq data mining. Further work should characterize the enzymes involved in the biosynthesis of HB.
Funding
This research was supported by the National Natural Science Foundation of China (Grant No.81460579), High-level Innovative Talents of Guizhou Province of China (Qian Ke He Platform and Talent [2018]5638), Science and Technology Project in Guizhou Province of China (Qian Ke He Platform and Talent [2019]5611), Key project at central government level: The ability establishment of sustainable use for valuable Chinese medicine resources (Grant No. 2060302) and First-class Discipline Construction Projects of Guizhou Province of China (GNYL(2017)008).
Statements
Data availability statement
The coding sequence for prePhHB can be found in GenBank, using accession number MH699110.
Author contributions
WZ, TZ, JL, and WJ planned and designed the research. WZ, JL, CY, and RX performed the experiments and analyzed the data. WZ, TZ, JZ, and WJ wrote the manuscript. CX, DW, CZ, AG, and YB contributed equally to this work.
Acknowledgments
We thank Jun Li, who provided us with the vectors pLGNL and wild-type tobacco seeds. We thank Ling Ding, Chuanzhi Kang, Dengkai Long, Haixia Shi, Jie Chen, Wangyin Feng, and Qing Liang for their help in experiments. We thank Guanghong Cui for her valuable comments in the revision of this article.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found at: https://www.frontiersin.org/articles/10.3389/fpls.2019.01259/full#supplementary-material
Figure S1Supplementary information for Figure 4. Identification of prePhHB-encoded linear peptide via HPLC and LC-MS. (A) Purity testing via HPLC. (B) Molecular weight detection via LC-MS.
Figure S2Supplementary information for Figure 4. HPLC chromatograms showing products of reactions with the conversion of preheterophyllin B (linear polypeptide) to HB (cyclic peptide) in vitro. (i) HB standard; (ii) Control group, no polypeptide was added; (iii) Polypeptide group (mAU, milli-absorbance unit; the unit of retention time is min).
Figure S3PCR amplification of the full-length coding sequence of prePhHB from genomic DNA extracted from transgenic tobacco. (A) PCR amplification using specific primers for the prePhHB gene. (B) PCR amplification using specific primers for the plant expression vector PLGNL. The left M is 5000 bp Marker and the right M is 500 bp Marker; CK1: Wild-type tobacco; CK2: PLGNL-prePhHB plasmid DNA; CK3: LBA4404-PLGNL-prePhHB bacteria liquid; Numbers 1 to 50: transgenic tobacco plants.
Figure S4Supplementary information for Figure 5. (A) Kanamycin sensitivity tests that the above picture is kanamycin-resistant plants and the following picture is albino plants. (B) RT-PCR analysis of relative mRNA levels of prePhHB and ACTIN in stems, leaves, and roots of transgenic and wild-type plants. ACTIN gene was used as an internal control. Transgenic lines (L1, L9, L10, L22, L25, L42 and L47) were transformed by Agrobacterium-mediated transformation containing the pLGNL-prePhHB.
References
1
ArnisonP. G.BibbM. J.BierbaumG.BowersA. A.BugniT. S.BulajG.et al. (2013). Ribosomally synthesized and post-translationally modified peptide natural products: overview and recommendations for a universal nomenclature. Nat. Prod. Rep.30, 108–160. doi: 10.1039/C2NP20085F
2
ArseneauJ. R.SteevesR.LaflammeM. (2017). Modified low-salt CTAB extraction of high-quality DNA from contaminant-rich tissues. Mol. Ecol. Resour.17, 686–693. doi: 10.1111/1755-0998.12616
3
BallesterM.CordonR.FolchJ. M. (2013). DAG expression: high-throughput gene expression analysis of real-time PCR data using standard curves for relative quantification. PLoS One8, e80385. doi: 10.1371/journal.pone.0080385
4
BiondaN.FasanR. (2017). Ribosomal synthesis of thioether-bridged bicyclic peptides. Methods Mol. Biol.1495, 57–76. doi: 10.1007/978-1-4939-6451-2_5
5
BurmanR.GruberC. W.RizzardiK.HerrmannA.CraikD. J.GuptaM. P.et al. (2010). Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry71, 13–20. doi: 10.1016/j.phytochem.2009.09.023
6
BurmanR.GunasekeraS.StromstedtA. A.GoranssonU. (2014). Chemistry and biology of cyclotides: circular plant peptides outside the box. J. Nat. Prod.77, 724–736. doi: 10.1021/np401055j
7
CaiY.ZhangC.HaoL.ChenJ.XieP.ChenZ. (2016). Systematic identification of seven ribosomal protein genes in bighead carp and their expression in response to microcystin-LR. J. Toxicol. Sci.41, 293–302. doi: 10.2131/jts.41.293
8
CascalesL.CraikD. J. (2010). Naturally occurring circular proteins: distribution, biosynthesis and evolution. Org. Biomol. Chem.8, 5035–5047. doi: 10.1039/c0ob00139b
9
CondieJ. A.NowakG.ReedD. W.BalsevichJ. J.ReaneyM. J.ArnisonP. G.et al. (2011). The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant. J.67, 682–690. doi: 10.1111/j.1365-313X.2011.04626.x
10
DalyN. L.ChenY. K.FoleyF. M.BansalP. S.BharathiR.ClarkR. J.et al. (2006). The absolute structural requirement for a proline in the P3’-position of Bowman-Birk protease inhibitors is surmounted in the minimized SFTI-1 scaffold. J. Biol. Chem.281, 23668–23675. doi: 10.1074/jbc.M601426200
11
FinkingR.MarahielM. A. (2004). Biosynthesis of nonribosomal peptides1 . Annu. Rev. Microbiol.58, 453–488. doi: 10.1146/annurev.micro.58.030603.123615
12
GillonA. D.SaskaI.JenningsC. V.GuarinoR. F.CraikD. J.AndersonM. A. (2008). Biosynthesis of circular proteins in plants. Plant. J.53, 505–515. doi: 10.1111/j.1365-313X.2007.03357.x
13
HanC.ShenY.ChenJ.LeeF. S.WangX. (2008). HPLC fingerprinting and LC-TOF-MS analysis of the extract of Pseudostellaria heterophylla (Miq.) Pax root. J. Chromatogr. B Analyt. Technol. Biomed. Life Sci.862, 125–131. doi: 10.1016/j.jchromb.2007.11.041
14
HenriquesS. T.HuangY. H.RosengrenK. J.FranquelimH. G.CarvalhoF. A.JohnsonA.et al. (2011). Decoding the membrane activity of the cyclotide kalata B1: the importance of phosphatidylethanolamine phospholipids and lipid organization on hemolytic and anti-HIV activities. J. Biol. Chem.286, 24231–24241. doi: 10.1074/jbc.M111.253393
15
HuJ.PangW.ChenJ.BaiS.ZhengZ.WuX. (2013). Hypoglycemic effect of polysaccharides with different molecular weight of Pseudostellaria heterophylla. BMC Complement Altern. Med.13, 267. doi: 10.1186/1472-6882-13-267
16
HuaY.HouY.WangS.MaY.LiuZ.ZouL.et al. (2016a). Comparison of chemical compositions in pseudostellariae radix from different cultivated fields and germplasms by NMR-based metabolomics. Molecules21 (11), 1538. doi: 10.3390/molecules21111538
17
HuaY.WangS.ChaiC.LiuZ.LiuX.ZouL.et al. (2016b). Quality evaluation of pseudostellariae radix based on simultaneous determination of multiple bioactive components combined with grey relational analysis. Molecules22 (10): E13. doi: 10.3390/molecules22010013
18
HuaY.WangS.LiuZ.LiuX.ZouL.GuW.et al. (2016c). Transcriptomic analysis of Pseudostellariae Radix from different fields using RNA-seq. Gene588, 7–18. doi: 10.1016/j.gene.2016.04.043
19
JhamandasJ. H.GoncharukV. (2013). Role of neuropeptide FF in central cardiovascular and neuroendocrine regulation. Front. Endocrinol. (Lausanne)4, 8. doi: 10.3389/fendo.2013.00008
20
JiaA.XiangL. I.TanN.LiuX.ShenY.ZhouJ. (2006). Enzymatic cyclization of linear peptide to plant cyclopeptide heterophyllin B. Sci. China Ser. B.49, 63–66. doi: 10.1007/s11426-005-0204-5
21
KerstenR. D.WengJ. K. (2018). Gene-guided discovery and engineering of branched cyclic peptides in plants. Proc. Natl. Acad. Sci. U. S. A.115, E10961–E10969. doi: 10.1073/pnas.1813993115
22
LiJ.ZhengW.LongD.DingL.GongA.XiaoC.et al. (2016). De novo sequencing and assembly analysis of the pseudostellaria heterophylla transcriptome. PLoS One.11, e0164235. doi: 10.1371/journal.pone.0164235
23
LuoH.Hallen-AdamsH. E.Scott-CraigJ. S.WaltonJ. D. (2012). Ribosomal biosynthesis of α-amanitin in Galerina marginata. Fungal Genet. Biol.49, 123–129. doi: 10.1016/j.fgb.2011.12.005
24
MoritaH.KayashitaT.TakeyaK.ItokawaH. (1995). Cyclic peptides from higher plants, Part 15. Pseudostellarin H, a new cyclic octapeptide from Pseudostellaria heterophylla. J. Nat. Prod.58, 943–947. doi: 10.1016/0012-821X(88)90038-6
25
NohH. J.HwangD.LeeE. S.HyunJ. W.YiP. H.KimG. S.et al. (2015). Anti-inflammatory activity of a new cyclic peptide, citrusin XI, isolated from the fruits of Citrus unshiu. J. Ethnopharmacol.163, 106–112. doi: 10.1016/j.jep.2015.01.024
26
OtzenD. E. (2017). Biosurfactants and surfactants interacting with membranes and proteins: same but different? Biochim. Biophys. Acta1859, 639–649. doi: 10.1016/j.bbamem.2016.09.024
27
PandeyM. B.SinghS.MalhotraM.PandeyV. B.SinghT. D. (2012). Two new 14-membered cyclopeptide alkaloids from Zizyphus xylopyra. Nat. Prod. Res.26, 836–841. doi: 10.1080/14786419.2011.559641
28
PangW.LinS.DaiQ.ZhangH.HuJ. (2011). Antitussive activity of Pseudostellaria heterophylla (Miq.) Pax extracts and improvement in lung function via adjustment of multi-cytokine levels. Molecules16, 3360–3370. doi: 10.3390/molecules16043360
29
PathiK. M.TulaS.TutejaN. (2013). High frequency regeneration via direct somatic embryogenesis and efficient Agrobacterium-mediated genetic transformation of tobacco. Plant Signal Behav.8, e24354. doi: 10.4161/psb.24354
30
PicurB.CebratM.ZabrockiJ.SiemionI. Z. (2006). Cyclopeptides of Linum usitatissimum. J. Pept. Sci.12, 569–574. doi: 10.1002/psc.779
31
RajuR.GromykoO.AndriyB.FedorenkoV.LuzhetskyyA.MullerR. (2014). Oleamycins A and B: new antibacterial cyclic hexadepsipeptides isolated from a terrestrial Streptomyces sp. J. Antibiot. (Tokyo)67, 339–343. doi: 10.1038/ja.2014.1
32
Rodriguez-VazquezN.OzoresH. L.GuerraA.Gonzalez-FreireE.FuertesA.PancieraM.et al. (2014). Membrane-targeted self-assembling cyclic peptide nanotubes. Curr. Top Med. Chem.14, 2647–2661. doi: 10.2174/1568026614666141215143431
33
SchmidtE. W.NelsonJ. T.RaskoD. A.SudekS.EisenJ. A.HaygoodM. G.et al. (2005). Patellamide A and C biosynthesis by a microcin-like pathway in Prochloron didemni, the cyanobacterial symbiont of Lissoclinum patella. Proc. Natl. Acad. Sci. U. S. A.102, 7315–7320. doi: 10.1073/pnas.0501424102
34
SpenglerJ.JimenezJ. C.BurgerK.GiraltE.AlbericioF. (2005). Abbreviated nomenclature for cyclic and branched homo- and hetero-detic peptides. J. Pept. Res.65, 550–555. doi: 10.1111/j.1399-3011.2005.00254.x
35
TanN. H.ZhouJ. (2006). Plant cyclopeptides. Chem. Rev.106, 840–895. doi: 10.1021/cr040699h
36
TantaiJ. C.ZhangY.ZhaoH. (2016). Heterophyllin B inhibits the adhesion and invasion of ECA-109 human esophageal carcinoma cells by targeting PI3K/AKT/beta-catenin signaling. Mol. Med. Rep.13, 1097–1104. doi: 10.3892/mmr.2015.4659
37
WaltonJ. D.Hallen-AdamsH. E.LuoH. (2010). Ribosomal biosynthesis of the cyclic peptide toxins of Amanita mushrooms. Biopolymers94, 659–664. doi: 10.1002/bip.21416
38
WangZ.LiaoS. G.HeY.LiJ.ZhongR. F.HeX.et al. (2013). Protective effects of fractions from Pseudostellaria heterophylla against cobalt chloride-induced hypoxic injury in H9c2 cell. J. Ethnopharmacol.147, 540–545. doi: 10.1016/j.jep.2013.03.053
39
XuW.ZhuH.TanN.TangJ.ZhangY.CernyR. L.et al. (2012). An in vitro system to study cyclopeptide heterophyllin B biosynthesis in the medicinal plant Pseudostellaria heterophylla. Plant Cell Tissue Organ108, 137–145. doi: 10.1007/s11240-011-0022-8
40
YangC.YouL.YinX.LiuY.LengX.WangW.et al. (2018). Heterophyllin B ameliorates lipopolysaccharide-induced inflammation and oxidative stress in RAW 264.7 Macrophages by Suppressing the PI3K/Akt Pathways. Molecules23 (4): E717. doi: 10.3390/molecules23040717
41
ZhaoW. O.PangL.DongN.YangS. (2015). LC-ESI-MS/MS analysis and pharmacokinetics of heterophyllin B, a cyclic octapeptide from Pseudostellaria heterophylla in rat plasma. Biomed. Chromatogr.29, 1693–1699. doi: 10.1002/bmc.3481
Summary
Keywords
cyclic peptide, heterophyllin B, gene, prePhHB, Pseudostellaria heterophylla
Citation
Zheng W, Zhou T, Li J, Jiang W, Zhang J, Xiao C, Wei D, Yang C, Xu R, Gong A, Zhang C and Bi Y (2019) The Biosynthesis of Heterophyllin B in Pseudostellaria heterophylla From prePhHB-Encoded Precursor. Front. Plant Sci. 10:1259. doi: 10.3389/fpls.2019.01259
Received
24 August 2018
Accepted
10 September 2019
Published
17 October 2019
Volume
10 - 2019
Edited by
Massuo Jorge Kato, University of São Paulo, Brazil
Reviewed by
Supaart Sirikantaramas, Chulalongkorn University, Thailand; Luciana Gonzaga De Oliveira, Campinas State University, Brazil
Updates

Check for updates
Copyright
© 2019 Zheng, Zhou, Li, Jiang, Zhang, Xiao, Wei, Yang, Xu, Gong, Zhang and Bi.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Tao Zhou, taozhou88@163.com; Weike Jiang, jwk_88@163.com
This article was submitted to Plant Metabolism and Chemodiversity, a section of the journal Frontiers in Plant Science
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.