Abstract
The existence of the nucleus distinguishes prokaryotes and eukaryotes. Apart from containing most of the genetic material, the nucleus possesses several nuclear bodies composed of protein and RNA molecules. The nucleus is separated from the cytoplasm by a double membrane, regulating the trafficking of molecules in- and outwards. Here, we investigate the composition and function of the different plant nuclear bodies and molecular clues involved in nuclear trafficking. The behavior of the nucleolus, Cajal bodies, dicing bodies, nuclear speckles, cyclophilin-containing bodies, photobodies and DNA damage foci is analyzed in response to different abiotic stresses. Furthermore, we research the literature to collect the different protein localization signals that rule nucleocytoplasmic trafficking. These signals include the different types of nuclear localization signals (NLSs) for nuclear import, and the nuclear export signals (NESs) for nuclear export. In contrast to these unidirectional-movement signals, the existence of nucleocytoplasmic shuttling signals (NSSs) allows bidirectional movement through the nuclear envelope. Likewise, nucleolar signals are also described, which mainly include the nucleolar localization signals (NoLSs) controlling nucleolar import. In contrast, few examples of nucleolar export signals, called nucleoplasmic localization signals (NpLSs) or nucleolar export signals (NoESs), have been reported. The existence of consensus sequences for these localization signals led to the generation of prediction tools, allowing the detection of these signals from an amino acid sequence. Additionally, the effect of high temperatures as well as different post-translational modifications in nuclear and nucleolar import and export is discussed.
Introduction: Cell compartmentalization and the nucleus
Cell compartmentalization allows the physical separation of molecules and metabolic reactions within the cell. In particular, plants possess and exert a large number of biochemical routes and metabolites because of their sessile character (Solymosi and Schoefs, 2019). Thus, compartmentalization is essential in plant cells for their correct functioning. During evolution, compartmentalization appeared as the distinction between eukaryotes and prokaryotes, since prokaryotic cells lack membrane-bound organelles. Interestingly, plant cells possess an exclusive organelle, the chloroplast, whose best-known function consists in obtaining energy through photosynthesis (; ; Solymosi and Schoefs, 2019).
Nevertheless, the nucleus can be conceived as the organelle distinguishing eukaryotic and prokaryotic cells. The nucleus contains most of the genetic material, excluding the mitochondrial and (in plants) the chloroplastic genomes (Figure 1). Functionally, it separates the DNA replication and DNA transcription taking place in the nucleoplasm from the protein translation in the cytosol. The nucleus also has a protective effect on the genetic material. Structurally, it comprises the nucleoplasm and the nuclear envelope (NE). The nucleoplasm contains the chromatin and the nuclear bodies, and it is also the site of several enzymes involved in the metabolism of DNA and RNA. On the other hand, the NE delimitates the nucleoplasm from the cytoplasm. It is composed of the outer nuclear membrane and the inner nuclear membrane (ONM and INM, respectively), forming the perinuclear space in-between. Whereas the ONM is in contact with the endoplasmic reticulum in the cytoplasm, the INM associates with the nuclear lamina, which is involved in several nuclear functions in animals cells (Taddei et al., 2004; ). The nucleoplasm and the cytoplasm are in contact through thousands of nuclear pore complexes (NPCs) located along the NE. In addition, actively transcribed chromatin is often found interacting with the NPC, whereas inactive chromatin is associated with the nuclear lamina in animals and yeast (Taddei et al., 2004; ) or with the periphery of the nucleolus in eukaryotic cells (; ; ; ; ).
FIGURE 1
Nuclear bodies are dynamic structures composed of proteins and RNA molecules involved in related functions (
TABLE 1
| Nuclear body | Protein components | RNA components | Function |
| Nucleolus (No) | Nucleolin Fibrillarin … | rRNAs C/D snoRNAs H/ACA snoRNAs | Ribosome biogensis Regulation of the cell cycle Stress response |
| Cajal bodies (CBs) | Coilin U2B Fibrillarin Dyskerin AGO4, DCL3 | snRNAs C/D snoRNAs H/ACA snoRNAs scaRNAs mRNAs | Modification of sRNAs Formation of spliceosomal particles Gene silencing (Arabidopsis) |
| Dicing bodies (D-bodies) | DCL1 HYL1 AGO1 DRB1 HEN1 | - | Gene silencing |
| Nuclear speckles | SR-rich proteins snRNPs non-snRNPs Transcription factors 3′ processing factors Cyclophilins | snoRNAs pre-mRNAs | Formation of spliceosomal particles |
| Cyclophilin-containing bodies | Cyclophilins (BypRS64) | - | Protein folding Plant development and signaling |
| Photobodies | Phytochromes Cryptochromes | - | Storage of active phytochromes Degradation of phytochromes |
| DNA damage foci | yH2AX RBR1 RAD51, RAD54 E2F | - | DNA damage response (DDR) |
Plant nuclear bodies.
The proteins and RNAs listed are considered to be major (abundance) components and normally used as compartmental markers.
In this review, we will consider the different plant nuclear bodies, from their protein and RNA composition to the functions and processes they are involved in. Moreover, the dynamics of nuclear bodies upon different stressors in animals, yeast and plants will be also addressed. In addition, the features of the different protein signals that govern nuclear and nucleolar import and export will be detailed. This review also focuses on how heat stress and main post-translational modifications (PTMs) modulate nuclear import and export.
Nuclear bodies
Nucleolus
The nucleolus is the most prominent subnuclear structure in eukaryotic cells. It is considered to be a nuclear body because of the presence of protein and RNA molecules. The nucleolus possesses a tripartite composition distributed in a vectorial fashion: fibrillar center (FC), dense fibrillar component (DFC) and granular component (GC), although in yeast the nucleolus exhibits a bipartite organization (Sáez-Vásquez and Gadal, 2010). The FCs are low-density areas surrounded by the DFC, which is embedded in the GC. Moreover, it is also common to find nucleolar cavities in plant nucleoli (
The nucleolus is largely known for its role in the biogenesis of ribosomes (
Transcribed pre-rRNAs (47S/45S/35S and 5S) undergo several processing steps by endo- and exonucleases to form the mature 5S, 5.8S, 18S and 25S (28S in mammals) rRNAs. In plants, this include endonucleases RTL2 (ribonuclease 3-like protein 2) and 5′-3′ and 3′-5′ exoribonuclease activities from XRN2 and the exosome, respectively (reviewed by Sáez-Vásquez and Delseny, 2019). In the processing of rRNA, both C/D and H/ACA small nucleolar ribonucleoproteins (snoRNPs) also play a central role in the modifications of the rRNAs. On the one hand, C/D snoRNPs are involved in the 2′-O-methyl ribose methylation of rRNAs, in which fibrillarin has been described in many species as the methyltransferase. In contrast to animals and yeast, two different genes encode fibrillarin in Arabidopsis thaliana, referred as Arabidopsis (AtFIB1 and AtFIB2;
The mature 5S, 5.8S and 25S rRNAs (28S rRNA in mammals), along with large ribosomal proteins (RPLs), form the large ribosomal particle (60S), while the small ribosomal particle (40S) contains the 18S rRNA plus small ribosomal proteins (
The number of nucleolar proteins in Arabidopsis is significantly lower than in humans (
The assembly and organization of the nucleolus are governed by liquid–liquid phase separation (LLPS;
During mitosis, the nucleus disappears in the majority of the eukaryotes, including animal and plants. The nucleolus disassembles in the early mitosis, becoming completely lost in the prometaphase. Nevertheless, some nucleolar components appear to be associated with the periphery of the chromosomes during the metaphase and anaphase as sheath-like structures. In the telophase, the sheath-like material forms the perinucleolar bodies (PNBs), which are recruited by the nucleolar organizer regions (NORs). This fact, along with the transcription of the rRNA genes, promotes the synthesis of new nucleoli in the daughter cells (
Cajal bodies and histone locus bodies
Cajal bodies are among the best-characterized nuclear bodies in animal, yeast and plant cells. They were discovered by Ramon y Cajal along with other nuclear bodies (reviewed by
Because of the diverse composition of CBs, these nuclear bodies take part in numerous functions. One of the most important processes involving CBs is the formation of spliceosomal particles (snRNPs). After being synthesized in the nucleoplasm, they are translocated to the cytosol to interact with Sm proteins. After methylation of the 5′ of the snRNAs, the snRNP complex moves back into the nucleus (Suzuki et al., 2010). Another function revolving CBs is the modification of small RNAs (sRNAs). The presence of C/D box snoRNAs and scaRNAs mediates the 2′-O-methyl ribose methylation of snRNAs, whereas H/ACA box snoRNAs promote 5-riboyluracil pseudouridinyation of RNA molecules in CBs (
Some functions attributed to CBs are specific to plants, i.e., the nonsense-mediated mRNA decay (NMD), a quality control mechanism for premature terminated mRNA molecules. Whereas this process takes place in the cytosol in human cells, the nonsense-mediated mRNA decay might occur in the nucleolus in plants. The nucleolar localization of the exon junction complex, mRNA molecules and Up-frameshift factors in plants sparked the idea of CBs involved in the nonsense-mediated mRNA decay. Nevertheless, this hypothesis must be fully demonstrated (
Histone locus bodies are another type of nuclear body involved in the processing of histone pre-mRNA, as they are associated with histone-coding genes. In fact, these bodies resemble CBs in terms of structure and composition. HLBs were first discovered in Drosophila melanogaster and human cells, even though they were considered to be CBs (
Dicing bodies
MicroRNAs (miRNAs) are a type of RNase III-dependent sRNAs involved in gene silencing. They are transcribed by the RNA Polymerase II (RNA Pol II) as pri-miRNAs, which are processed by the DCL1-HYL-SE complex into a duplex miRNA. Then, these duplexes associate with ARGONAUTE proteins to form the RISC complex in order to exert their function (reviewed by
Nuclear speckles and paraspeckles
Nuclear speckles constitute another type of common nuclear body present in animal and plant cells (Reddy et al., 2012). These bodies are located in the interchromatin space, and they store splicing factors, as well as snRNPs, non-snRNPs, transcription factors and 3′ processing factors (
Serine/arginine (SR)-rich proteins are splicing proteins involved in recognition of pre-mRNA introns and in the assembly of the spliceosome (
Paraspeckles have been described in animals and are composed of non-coding RNA molecules and proteins. They have not been described in plants (Spector and Lamond, 2011; Reddy et al., 2012).
Cyclophilin-containing bodies
Cyclophilins are a family of proteins that are present in many organelles in plant cells (Singh et al., 2020). They are believed to be involved in protein folding, possibly mediating the assembly of the spliceosome. Recently, it has been observed that cyclophilins constitute versatile proteins that exert a wide array of functions in plant development and signaling (Schmid, 1995;
Photobodies
Phytochromes (phys) are photoreceptors responsible for the red (R) and far-red (FR) sensing (Schâfer et al., 1972). They possess inactive and active conformations, referred as R light-absorbing Pr and FR light-absorbing Pfr forms, respectively. In Arabidopsis, there are five types of phys (phyA–phyE). Among them, the most prominent in Arabidopsis are phyA, which senses R, FR and blue light, and phyB, which responds to R light (van Buskirk et al., 2012). Interestingly, the conversion from Pr to Pfr leads to the translocation of phys from the cytosol into the nucleus (
Structurally, phys are able to form either homodimers or heterodimers. Each monomer possesses a N-terminal domain to sense light, and a C-terminal domain to allow dimerization (
DNA damage foci
Because of the sessile character of plants, they are highly exposed to several adverse conditions that lead to DNA damage. However, the mutation rate is very low due to the existence of reparation mechanisms. One of these is called the DNA damage response (DDR), which is highly conserved among animals and plants. The DDR starts with the activation of the protein kinases ataxia telangiectasia mutated (ATM) by double strand breaks (DSBs), and ATM- and Rad3-related (ATR) proteins by single strand (SS) DNA. Then, the suppressor of gamma-response 1 (SOG1) is phosphorylated, promoting the transcription of DNA repair genes and the regulation of the cell cycle. However, there is a SOG1-independent DDR, which involves E2F-retinoblastoma-related protein 1 (RBR1) complexes (reviewed by
DNA damage foci appear at sites of double-stranded damage in animals, yeast and plants. It has been hypothesized that LLPS, similar to the nucleolus, governs the formation of these bodies (reviewed by
Nuclear granules and bodies under stress
Eukaryotic cells are often exposed to unfavorable conditions, such as extreme temperatures or hypoxia. These stresses activate different types of cellular responses to mitigate and/or fight the adverse conditions (
FIGURE 2

Representation of the different nuclear aggregates originating under stress conditions in mammals, yeast, and plants. In mammal cells (top) two different nuclear granules are represented: the nuclear stress granules (SGs), formed in the nucleoplasm (Np) upon viral infection, hypoxia or UV exposure; and the A-bodies, formed in the nucleolus (No) in response to acidosis or heat stress. In the middle, the generation of nuclear aggregates in yeast is driven by acute heat stress. While nuclear/nucleolar proteins form the nucleolar ring (No-Ring) in fission yeast (Schizosaccharomyces pombe), the intra-nuclear quality-control compartment (INQ) appears in the nuclei of budding yeast (Saccharomyce cerevisiae) in contact with the nucleolus. On the bottom, the loss of the nucleolar structure occurs in plant cells upon heat stress, whereas the presence of a round structure occurs during chilling temperatures. Moreover, the formation of AKIP1-containing bodies in the nucleus was observed in Vicia faba in the presence of abscisic acid (ABA).
High temperatures induce the enlargement of CDKC2-containing nuclear speckles, whereas cold treatment inhibits their formation (
Different cellular bodies are formed in response to abiotic stress. In the cytosol of plant cells, stress granules and heat stress granules appear upon short- and long-term exposure to heat stress, respectively. They can also be differentiated according to their protein and RNA composition (reviewed by
Moreover, the amyloid bodies (A-bodies) are formed in the nucleoplasm of human cells in response to various stimuli such as hypoxia, heat stress or acidosis (Figure 2). The protein content of these A-bodies [also referred as Detention Center in
In Arabidopsis, abiotic stress modulates the composition of certain nuclear bodies. For instance, early flowering 3 (ELF3), a component of the evening complex, forms nuclear speckles in response to high temperatures. The C-terminal prion domain of ELF3 is responsible for this behavior (
Moving into and out of the nucleus
In order to exert their function, nuclear proteins, synthesized in the cytosol, need to cross the NE through the NPC. As mentioned before, the NPCs are embedded in the nuclear membrane, creating a channel between the cytoplasm and the nucleoplasm. These cylindrical structures constitute the largest macromolecular complexes present in eukaryotic cells. Morphologically, each NPC is composed by a cytoplasmic and a nucleoplasmic ring, connected by eight spokes. A basket-like structure has been observed in the nucleoplasmic side of the NPC, whereas some fibrillar structures are present in the cytoplasmic face. The main component of the NPC are proteins known as nucleoporins, which are partially conserved in eukaryotes (
FIGURE 3

Representation of proteins containing nuclear and/or nucleolar signals involved in their translocation between the cytoplasm, the nucleoplasm and/or the nucleolus. A classical nuclear localization signal (cNLS) including monopartite and bipartite classical signals (MP and BP cNLS, respectively); ncNLS, non-classical nuclear localization signals; NES, nuclear export signal; NoLS, nucleolar localization signal; GAR, glycine arginine rich domain. In mammalian cells certain proteins might also contain an nucleoplasmic localization signal (NpLS), nucleolar exclusion signals (NoES) and/or amyloid-converting motif (ACM, also referred as nucleolar detention signal or NoDS). In response to heat/acidosis the ACM interacts with IGS-derived lncRNA, forming the A-bodies (or detention centers).
Nuclear import
The nuclear import mechanism includes the movement of proteins from the cytosol into the nucleus. The molecular players in this mechanism have been characterized in eukaryotes. In animals, there are different nuclear import pathways depending on the protein–protein interactions (Stewart, 2007).
The classical nuclear import pathway includes the cytosolic importin β. This protein interacts with the target nuclear protein through an adaptor protein, importin α, which recognizes a specific motif of the target nuclear protein. The complex importin α–nuclear protein–importin β migrates into the nucleoplasm via interaction with proteins from the NPC. In the nucleus, Ran-GTP promotes the dissociation of importin α, importin β and the target nuclear protein. Importin α moves back into the cytoplasm by interaction with the β-karyopherin CAS and Ran-GTP. At the same time, importin β, along with Ran-GTP, migrates back to the cytoplasm. The hydrolysis of Ran-GTP into Ran-GDP by Ran GTPase-activating protein allows its dissociation from importin β (Smith et al., 1998; Sazer and Dasso, 2000;
The specific sequence of the target nuclear protein recognized by importin α is known as the nuclear localization signal (NLS). Unlike other localization signals, such as mitochondrial and plastid signals, NLSs are not proteolytically removed after nuclear import, allowing nuclear proteins to participate in more than one round of nuclear transport. These localization signals can be found in the N- and/or C-terminus, as well as within the protein (
The second class of NLSs is known as non-classical NLSs (ncNLSs). This type comprises NLSs whose composition varies from positively charged residues. The best-known ncNLSs are the proline-tyrosine (PY) ncNLSs, which are composed of 20–30 residues with a basic or hydrophobic N-terminus and a common C-terminal motif ([basic/hydrophobic]-Xn-R/H/K-X(2–5)-P-Y, where X represents any amino acid; Wang et al., 2012;
In plants, several NLSs have been characterized both in silico and experimentally. Examples include the E3 ubiquitin-protein ligase COP1 in Arabidopsis, a repressor of the photomorphogenesis. This protein exhibits nuclear localization owing to the presence of a bipartite cNLS (294RKKRIHAQFNDLQECYLQKRRQLA317; Stacey and Von Arnim, 1999). Another example is the Arabidopsis transcriptional elongation regulator MINIYO, which possesses two NLSs in its sequence. One of them is a monopartite cNLS located in the N-terminus (254LKKRKH259), whereas the other is a bipartite cNLS present in the C-terminus (1401RKRHREGMMLDLLRYKK1417;
TABLE 2
| Protein | Organism | Sequence1 | Type | References |
| Nuclear localization signals (NLS) | ||||
| COP1 | Arabidopsis thaliana | 294RKKRIHAQFNDLQECYLQKRRQLA317 | BP cNLS | Stacey and Von Arnim (1999) |
| MINIYO | Arabidopsis thaliana | 254LKKRKH259 | MP cNLS | |
| 1401RKRHREGMMLDLLRYKK1417 | BP cNLS | |||
| RTL2 | Arabidopsis thaliana | 371KKAESSSAYHMIRALRK387 | BP cNLS | |
| Hsfa1 | Arabidopsis thaliana | 230KEKKSLFGLDVGRKRR245 | BP cNLS | |
| Coilin | Arabidopsis thaliana | 175KRKK178 | MP cNLS | |
| 264KKAKR268 | MP cNLS | |||
| Protein R | Zea mays | 100CDRRAAPARP109 | MP cNLS | |
| 419MSERKRREKL428 | MP cNLS | |||
| 598 MISESLRKAICKR610 | ncNLS | |||
| 60S ribosomal protein L13-1 | Brassica napus | 29RKTRRRVARQKKAVK43 | N/S | Sáez-Vásquez et al. (2000) |
| Nucleoplasmin | Xenopus laevis | 155KRPAATKKAGQAKKKK170 | BP cNLS | |
| ERK5 | Homo sapiens | 505RKPVTAQERQREREEKRRRRQERA KEREKRRQERE539 | BP cNLS | |
| CCTα | Homo sapiens | 12RKRRK16 | MP cNLS | Taneva et al. (2012) |
| SV40 | Simian virus | 126PKKKRKV132 | MP cNLS | |
| N protein | Porcine reproductive and respiratory syndrome virus | 10KRRK137 | MP cNLS | Rowland and Yoo (2003) |
| 41PGKKNKK4 | MP cNLS | |||
Nuclear localization signals.
cNLS, classical nuclear localization signal; ncNLS, non-classical nuclear localization signal; MP, monopartite; BP, bipartite; N/S, non-specified. 1The two positively charged amino acid clusters of the BP cNLSs are underlined.
Nuclear export
In contrast to nuclear import, the mechanisms that govern the movement of proteins from the nucleoplasm to the cytoplasm have been much less characterized. There are few examples of transporters of proteins from the nucleoplasm into the cytoplasm. One of them is Exportin1 (CRM1), which is known to specifically interact with nuclear proteins in order to translocate them into the cytoplasm (
The specific region of the nuclear proteins that is recognized by CRM1/AtXPO1 is called the nuclear export signal (NES). The existence of NESs was initially described in the HIV-1 Rev protein (75LPPLERLTLD84), involved in the export of pre-mRNAs and mRNAs from the nucleus, and the heat-stable inhibitor (PKI) of cAPK (38LALKLAGLDI47;
TABLE 3
| Protein | Organism | Sequence | References |
| Nuclear export signals (NES) | |||
| RanBP1a | Arabidopsis thaliana | 171DTAGLLEKLTVEETKTEEKT190 | |
| RTL2 | Arabidopsis thaliana | 7PEYNFPAITRCSLSNSLPHR26 | |
| TFIIIA | Xenopus laevis | 357SLVLDKLTI365 | |
| PKI | Homo sapiens | 38LALKLAGLDI47 | Wen et al. (1995) |
| N protein | Porcine reproductive and respiratory syndrome virus | 106LPTHHTVRLIRV117 | Rowland and Yoo (2003) |
| Rev protein | HIV-1 | 75LPPLERLTLD84 | |
| Nucleocytoplasmic Shuttling Signals (NSS) | |||
| hnRNP A1 | Homo sapiens | 316GNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY357 | Siomi and Dreyfuss (1995) |
| DAZAP1 | Homo sapiens | 383GPPAGGSGFGRGQNHNVQGFHPYRR407 | |
| RNA helicase A | Homo sapiens | 1151GSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGG YGSGGYGGSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPS GGYRGSGGFQRGGGRGAYGTGY1260 | Tang et al. (1999) |
Nuclear export signals and nucleocytoplasmic shuttling signals.
Bidirectional signals
Another type of localization signal that mediates nucleocytoplasmic trafficking has been described. In contrast to the NLSs or NESs, which exert a unilateral translocation of proteins, the nucleocytoplasmic shuttling signals (NSSs) allow both import and export of proteins to/from the nucleus in human cells. Many NSS-containing proteins interact with mRNA molecules. These motifs are longer and lack basic residues (
Moving into and out of the nucleolus
Nucleolar localization signal
Once in the nucleus, proteins can diffuse in the nucleoplasm or migrate into the nucleolus and/or other bodies. Unlike nuclear targeting, the mechanism and localization signals that regulate the translocation of proteins into the nucleolus remain highly unexplored (Figure 3). Over the years, several proteins have been predicted to possess a nucleolar localization signal (NoLS). These signals are rich in basic amino acids, especially Lys and Arg, preferentially located in the C- or N-terminus of proteins. Moreover, the NoLSs are predicted to be present in alpha helices or random coils located on the surface of the protein (Scott et al., 2010). For a peptide to achieve nucleolar localization it must be positively charged, formed exclusively of six or more arginines, and with an isoelectric point above 12.6 (
The existence of NoLSs have been predicted in silico and experimentally confirmed. For instance, both isoforms of the Arabidopsis ribosomal protein RPL23a (RPL23aA and RPL23aB) accumulate in the nucleolus owing to an NLS/NoLS region (
TABLE 4
| Protein | Organism | Sequence | References |
| Nucleolar Localization Signals (NoLS) | |||
| Coilin | Arabidopsis thaliana | 202KKKKKKK208 | |
| RPL23a1 | Arabidopsis thaliana | 33KKDK36 | |
| 36KKIR39 | |||
| Coilin | Homo sapiens | 160KKNKRNL168 | |
| NGP-12 | Homo sapiens | 1MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNM YRQKERRNSRGKIIKPLQYQSTVASGTVARVEPNIKWFGNTRVIKQ SSLQKFQEEMD100 | |
| 631DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEED VDDRAPSKKGKKRKAQREEEQEHSNKAPRALTSKERRRAVRQQRP KKVGVRYYETHNVKNRNRNKKKTNDSEGQ KHKRKKFRQKQ701 | |||
| N protein | Porcine reproductive and respiratory syndrome virus | 41PGKKNKKKNPEKPHFPLATEDDVRHHFTPSER72 | Rowland and Yoo (2003) |
| Nucleolar Export Signals (NoES) | |||
| GNL3L3 | Homo sapiens | 292EVYLDKFIRLLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVET ILQRCNLEEISNYYGVSGFQTTEHFLTAVAHRLGKKKKGGLYSQEQAAK AVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIEDTEQAN EDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTVYKI GDLTGYCTNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRI METDP531 | |
| NGP-13 | Homo sapiens | 349QYITLMRRIFLIDCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIG AVLERAKPEYISKTYKIDSWENAEDFLEKLAFRTGKLLKGGEPDLQTV GKMVLNDWQRGRIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNP GEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINV VPQFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEE NVGNDTKAVIKAL DEKIAKYQKFLDKAKAKKFS620 | |
| TdIF2/ERBP | Homo sapiens | 441VLLVL445 | |
Nucleolar localization signals and nucleolar exclusion signals.
1These sequences are described as NLS/NoLS.
2The N- and C-terminal regions are responsible for the nucleolar accumulation; the sequence of the NoLS is not detailed.
3These sequences are named nucleoplasmic localization signals (NpLSs).
It is widely thought that the nucleolar localization of many proteins is the result of the association with nucleolar components, such as rRNA (Schmidt-Zachmann and Nigg, 1993; Scott et al., 2010). In mammal cells, many ribosomal components adopt nucleolar localization by interaction with B23, the major constituent of the granular component of the nucleolus (
Nucleoplasmic localization signal
Two different types of signals that prevent nucleolar accumulation have been characterized in humans (
In terms of composition, NoLSs and NLSs have a similar composition, since both contain basic residues. In some cases, nucleolar signals were initially predicted to be nuclear signals because of their similarity. Thus, the experimental validation of predicted nucleolar signals, as well as nuclear signals, is fundamental to fully characterizing the nuclear and/or nucleolar localization of a protein. A classification of NLSs and NoLSs consists of (i) NLS-only signals, responsible for nuclear localization, (ii) NoLS-only signals, which determine localization exclusively in the nucleolus, and (iii) joint NLS–NoLS regions, which lead to accumulation of proteins in the nucleus and the nucleolus (Scott et al., 2010). Likewise, leucine is a common residue of NESs and NoESs. Nevertheless, the NoES characterized by Fukada et al. (441VLLVL445) cannot be included in any of the consensus NESs described above.
Nuclear and nucleolar accumulation under heat stress: Amyloid-converting motif/nucleolar detention signal
Part of the heat stress response includes inhibition or induction of specific protein activities. For that, transcription factors (TFs) are responsible of transforming the perception of the stressor into the expression of key genes. More specifically, heat stress transcription factors (HSFs) play a central role in gene transcription under different abiotic stresses, including heat stress (
This nuclear translocation upon heat stress has also been described in human cells. As mentioned previously (see the section: Nuclear granules and bodies under stress), some proteins are retained in the nucleus, forming A-bodies in response to heat stress. This phenomenon was initially called nucleolar sequestration of proteins, including the heat shock protein 70 (Hsp70) or the E3 ubiquitin-protein ligase MDM2. The ACM, which is the peptide responsible for this behavior, was originally defined as a nucleolar detention signal (NoDS). These signals are characterized by the presence of an arginine motif (R-R-L/I) and two or more hydrophobic triplets (L-φ-L/V, where φ represents a hydrophobic residue). Likewise, there is a physical interaction between the NoDS and IGS-derived lncRNAs, transcribed in response to high temperatures (
In silico prediction tools for nuclear and nucleolar signals
The existence of consensus sequences of localization signals, such as NLSs or NESs, allows their prediction using computational methods. There is a wide array of online platforms and in silico methods to predict the existence of NLSs from an amino acid sequence. For instance, “NLStradamus” is based on a Hidden Markov Model and used to find cNLSs from yeast sequences (
On the other hand, the prediction of nucleolar signals is challenging. First of all, the only well-stablished nucleolar signal is the NoLS, since few nuclear export signals have been described (see the above NoESs and NpLSs). Moreover, NoLSs are considerably similar to NLSs, both containing arginine and lysine residues. The web server “NoD” appears to be the best tool to predict an NoLS. It predicts the presence of an NoLS from the protein sequence, using the human-trained artificial neural network. Even though “NoD” performs best using mammal and mammalian-infecting viral proteins, it can also be used with plant and plant virus proteins (Scott et al., 2010, 2011).
Post-translational modifications and nuclear localization
Post-translational modifications consist of the addition of functional groups, or even cleavage, of certain domains. These modifications change the properties of proteins, promoting functional diversity. The best-known PTMs conform the addition of chemical groups, which can be reversible or irreversible, including phosphorylation, methylation, acetylation, or ubiquitination. These modifications have an impact on many aspects of the protein, i.e., activity, half-life, interaction with other molecules, or subcellular localization (
Phosphorylation
Phosphorylation is the best-characterized PTM. The addition of a phosphate negatively or positively influences the function of a protein. To couple and uncouple phosphate groups, kinases and phosphatases are necessary, respectively. Phosphorylation can also enhance or inhibit nuclear transport through different mechanisms (
Several examples in which phosphorylation enhances nuclear import in plants can be found in the literature. For instance, the Arabidopsis ssDNA binding protein WHIRLY (WHY1) is present in the nucleus and in the chloroplast under normal conditions. When WHY1 is phosphorylated by the calcineurin B-like-interacting protein kinase 14 (CIPK14), it accumulates predominantly in the nucleus (Ren et al., 2017). Another example is the movement of 14-3-3 proteins from the cytosol to the nucleus upon phosphorylation by the cold-activated plasma membrane protein cold-responsive protein kinase 1 (CRPK1;
In lymphocyte T cells, the nuclear factor of activated T cells (NFAT) has an NLS and NES. Low Ca2+ levels cause phosphorylation of the SRR2 region, which overlaps with the NLS, promoting cytoplasmic localization of the NFAT. On the other hand, nuclear accumulation of the NFAT has been observed with high levels of Ca2+ owing to dephosphorylation (
Acetylation and methylation
The addition of an acetyl group is catalyzed by acetyltransferases using acetyl CoA as a cofactor. In contrast, the removal of the acetyl group is catalyzed by deacetylases. Protein acetylation becomes necessary in certain situations, such as protein–protein interaction, chromatin stability or nuclear transport (Yang and Seto, 2008;
From another perspective, the acetylation of a component of the nuclear import machinery has an impact on the actual nuclear import rate in Arabidopsis. For instance, acetylation of the Lys18 of Nup50, which promotes the dissociation of importin α from the nuclear protein, decelerates this dissociation, repressing the nuclear import (
Protein methylation is a reversible PTM that occurs in the nucleus. Even though many residues can be methylated, this PTM is most common in arginine and lysine (reviewed by
SUMOylation and Ubiquitination
The attachment of a small ubiquitin-like modifier (SUMO) to proteins involves three different enzymes: (i) the activating enzyme or E1, (ii) the conjugating enzyme or E2, and (iii) the ligase or E3. This PTM is crucial in several processes, such as the regulation of the cell cycle, subcellular localization or transcription (reviewed by
Ubiquitination is a reversible PTM in which the C-terminus of an active ubiquitin is attached to a protein. Even though ubiquitination can occur in all 20 amino acids, it is more frequent in lysine residues. Similar to SUMOylation, the ubiquitin junction requires three enzymes: (i) the activating enzyme or E1, (ii) the conjugating enzyme or E2, and (iii) the ligase or E3. This reversible modification is normally associated with protein degradation via ubiquitin-proteasome. However, some effects in nuclear translocation have been described (
Perspectives
The purpose of this review is to gather global information concerning nuclear bodies in plants and, in particular, to survey their composition (proteins and RNA) and the peptide or amino acid sequence/structure signals involved in their localization and assembly. We did not intend to present an exhaustive catalog of protein and molecular bases involved in the assembly of nuclear bodies in plants, but rather to establish the current state of the art of these bodies in response to environmental conditions in plants and, more specifically, in response to abiotic stresses. Comparison of the behaviors of conserved nucleolar bodies revealed certain functional and structural similarities in yeast, animal and plant cells. However, under specific environmental conditions, particular nuclear bodies are formed and/or reorganized distinctly. For instance, this pertains to the nucleolus under heat stress conditions. Thus, although under optimal growth conditions nuclear bodies might have similar functions, key differences might appear upon specific developmental and environmental conditions. This is particularly true for plants, which are sessile organisms subjected to major developmental programs (including seed germination and flowering) and constrained to adapt to or resist stressful conditions (biotic and abiotic) to survive. The functional, structural and molecular clues of these bodies remain elusive and deserve further study to better understand the underlying molecular mechanism of nuclear bodies in plants.
Statements
Author contributions
EM-D and JS-V wrote the review. Both authors contributed to the article and approved the submitted version.
Funding
This work was supported by grants from the ANR, RiboStress 17-CE12-0026-01, MetRibo ANR-20-CE12-0024-01, and a Ph.D. fellowship from CNRS to EM-D (UMR5096-JULSAE-004). This study is set within the framework of the “Laboratoires d’Excellences (LABEX)” TULIP (ANR-10-LABX-41) and of the “Ecole Universitaire de Recherche (EUR)” TULP-GS (ANR-18-EURE-00019).
Acknowledgments
We thank Carlos Fernández Tornero for the detailed critical reading of the manuscript.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
References
1
AdamS. A.LobltT. J.MitchelltM. A.GeraceL. (1989). Identification of specific binding proteins for a nuclear location sequence.Nature337276–279. 10.1038/337276a0
2
AlbertsB.JohnsonA.LewisJ. (2002). “The compartmentalization of cells,” in molecular biology of the cell, 4th Edn. New York, NY: Garland Science.
3
AndradeL. E. C.ChanE. K. L.RaskaI.PeeblesC. L.RoosG.TanE. M. (1991). Human autoantibody to a novel protein of the nuclear coiled body: Immunological characterization and cDNA Cloning of p80-coilin.J. Exp. Med.1731407–1419. 10.1084/jem.173.6.1407
4
AngelovD.BondarenkoV. A.AlmagroS.MenoniH.MongélardF.HansF.et al (2006). Nucleolin is a histone chaperone with FACT-like activity and assists remodeling of nucleosomes.EMBO J.251669–1679. 10.1038/sj.emboj.7601046
5
AsakawaH.YangH. J.HiraokaY.HaraguchiT. (2016). Virtual nuclear envelope breakdown and its regulators in fission yeast meiosis.Front. Cell Dev. Biol.4:5. 10.3389/fcell.2016.00005
6
AudasT. E.AudasD. E.JacobM. D.HoJ. J. D.KhachoM.WangM.et al (2016). Adaptation to stressors by systemic protein amyloidogenesis.Dev. Cell39155–168. 10.1016/j.devcel.2016.09.002
7
AudasT. E.JacobM. D.LeeS. (2012a). Immobilization of proteins in the nucleolus by ribosomal intergenic spacer noncoding RNA.Mol. Cell45147–157. 10.1016/j.molcel.2011.12.012
8
AudasT. E.JacobM. D.LeeS. (2012b). The nucleolar detention pathway: A cellular strategy for regulating molecular networks.Cell Cycle112059–2062. 10.4161/cc.20140
9
Azevedo-FavoryJ.GaspinC.AyadiL.MontaciéC.MarchandV.JobetE.et al (2021). Mapping rRNA 2’-O-methylations and identification of C/D snoRNAs in Arabidopsis thaliana plants.RNA Biol.181760–1777. 10.1080/15476286.2020.1869892
10
BallasN.CitovskyV. (1997). Nuclear localization signal binding protein from Arabidopsis mediates nuclear import of agrobacterium VirD2 protein.Proc. Natl. Acad. Sci. U.S.A.9410723–10728. 10.1073/pnas.94.20.10723
11
BananiS. F.LeeH. O.HymanA. A.RosenM. K. (2017). Biomolecular condensates: Organizers of cellular biochemistry.Nat. Rev. Mol. Cell Biol.18285–298. 10.1038/nrm.2017.7
12
BarnecheF.SteinmetzF.EcheverrıìaM. (2000). Fibrillarin genes encode both a conserved nucleolar protein and a novel small nucleolar RNA involved in ribosomal RNA methylation in Arabidopsis thaliana.J. Biol. Chem.27527212–27220. 10.1074/jbc.M002996200
13
BassettC. L. (2012). Cajal bodies and Plant RNA metabolism.CRC. Crit. Rev. Plant Sci.31258–270. 10.1080/07352689.2011.645431
14
BauerD.VicziánA.KircherS.NobisT.NitschkeR.KunkelT.et al (2004). Constitutive photomorphogenesis 1 and multiple photoreceptors control degradation of phytochrome interacting factor 3, a transcription factor required for light signaling in Arabidopsis.Plant Cell161433–1445. 10.1105/tpc.021568
15
BelfieldJ. L.WhittakerC.CaderM. Z.ChawlaS. (2006). Differential effects of Ca2+ and cAMP on transcription mediated by MEF2D and cAMP-response element-binding protein in hippocampal neurons.J. Biol. Chem.28127724–27732. 10.1074/jbc.M601485200
16
BernhoferM.GoldbergT.WolfS.AhmedM.ZauggJ.BodenM.et al (2018). NLSdb-major update for database of nuclear localization signals and nuclear export signals.Nucleic Acids Res.46D503–D508. 10.1093/nar/gkx1021
17
BevenA. F.SimpsonG. G.BrownJ. W. S.ShawP. J. (1995). The organization of spliceosomal components in the nuclei of higher plants.J. Cell Sci.108509–518. 10.1242/jcs.108.2.509
18
BhogarajuS.DikicI. (2016). Ubiquitination without E1 and E2 enzymes.Nature53343–44. 10.1038/nature17888
19
BiamontiG.Vourc’hC. (2010). Nuclear stress bodies.Cold Spring Harb. Perspect. Biol.2:a000695. 10.1101/cshperspect.a000695
20
BiedermannS.HarashimaH.ChenP.HeeseM.BouyerD.SofroniK.et al (2017). The retinoblastoma homolog RBR1 mediates localization of the repair protein RAD51 to DNA lesions in Arabidopsis.EMBO J.361279–1297. 10.15252/embj.201694571
21
BischoffF. R.GörlichD. (1997). RanBP1 is crucial for the release of RanGTP from importin β-related nuclear transport factors.FEBS Lett.419249–254. 10.1016/s0014-5793(97)01467-1
22
Bongiorno-BorboneL.De ColaA.VernoleP.FinosL.BarcaroliD.KnightR. A.et al (2008). FLASH and NPAT positive but not coilin positive Cajal bodies correlate with cell ploidy.Cell Cycle72357–2367. 10.4161/cc.6344
23
BorerR. A.LehnerC. F.EppenbergerH. M.NiggE. A. (1989). Major nucleolar proteins shuttle between nucleus and cytoplasm.Cell56379–390. 10.1016/0092-8674(89)90241-9
24
BoudonckK.DolanL.ShawP. J. (1999). The movement of coiled bodies visualized in living plant cells by the green fluorescent protein.Mol. Biol. Cell102297–2307. 10.1091/mbc.10.7.2297
25
BoveJ.KimC. Y.GibsonC. A.AssmannS. M. (2008). Characterization of wound-responsive RNA-binding proteins and their splice variants in Arabidopsis.Plant Mol. Biol.6771–88. 10.1007/s11103-008-9302-z
26
CampellB. R.SongY.PoschT. E.CullisC. A.TownC. D. (1992). Sequence and organization of 5S ribosomal RNA-encoding genes of Arabidopsis thaliana.Gene112225–228. 10.1016/0378-1119(92)90380-8
27
CaoX.LiC.XiaoS.TangY.HuangJ.ZhaoS.et al (2017). Acetylation promotes TyrRS nuclear translocation to prevent oxidative damage.Proc. Natl. Acad. Sci. U.S.A.114687–692. 10.1073/pnas.1608488114
28
CastelB.ChaeE. (2021). Nucleocytoplasmic trafficking during immunity.Mol. Plant141612–1614. 10.1016/j.molp.2021.08.008
29
Caudron-HergerM.PankertT.SeilerJ.NémethA.VoitR.GrummtI.et al (2015). Alu element-containing RNAs maintain nucleolar structure and function.EMBO J.342758–2774. 10.15252/embj.201591458
30
ChenL.MaY.QianL.WangJ. (2013). Sumoylation regulates nuclear localization and function of zinc finger transcription factor ZIC3.Biochim. Biophys. Acta Mol. Cell Res.18332725–2733. 10.1016/j.bbamcr.2013.07.009
31
ChenM.SchwabR.ChoryJ. (2003). Characterization of the requirements for localization of phytochrome B to nuclear bodies.Proc. Natl. Acad. Sci. U.S.A.10014493–14498. 10.1073/pnas.1935989100
32
ChenM.TaoY.LimJ.ShawA.ChoryJ. (2005). Regulation of phytochrome B nuclear localization through light-dependent unmasking of nuclear-localization signals.Curr. Biol.15637–642. 10.1016/j.cub.2005.02.028
33
ChoH. S.ShimazuT.ToyokawaG.DaigoY.MaeharaY.HayamiS.et al (2012). Enhanced HSP70 lysine methylation promotes proliferation of cancer cells through activation of Aurora kinase B.Nat. Commun.3:1072. 10.1038/ncomms2074
34
ChoudharyC.KumarC.GnadF.NielsenM. L.RehmanM.WaltherT. C.et al (2009). Lysine acetylation targets protein complexes and Co-regulates major cellular functions.Science325834–840. 10.1126/science.1175371
35
ClackT.ShokryA.MoffetM.LiuP.FaulM.SharrockR. A. (2009). Obligate heterodimerization of Arabidopsis phytochromes C and E and interaction with the PIF3 basic helix-loop-helix transcription factor.Plant Cell21786–799. 10.1105/tpc.108.065227
36
CokolM.NairR.RostB. (2000). Finding nuclear localization signals.EMBO Rep.1411–415. 10.1093/embo-reports/kvd092
37
CollierS.PendleA.BoudonckK.van RijT.DolanL.ShawP.et al (2006). A distant coilin homologue is required for the formation of Cajal bodies in Arabidopsis.Mol. Biol. Cell172942–2951. 10.1091/mbc.e05-12-1157
38
ComellaP.PontvianneF.LahmyS.VignolsF.BarbezierN.DeBuresA.et al (2008). Characterization of a ribonuclease III-like protein required for cleavage of the pre-rRNA in the 3’ETS in Arabidopsis.Nucleic Acids Res.361163–1175. 10.1093/nar/gkm1130
39
ContrerasR.KallemiP.González-GarcíaM. P.LazarovaA.Sánchez-SerranoJ. J.SanmartínM.et al (2019). Identification of domains and factors involved in MINIYO nuclear import.Front. Plant Sci.10:1044. 10.3389/fpls.2019.01044
40
CréancierL.PratsH.ZanibellatoC.AmalricF.BuglerB. (1993). Determination of the functional domains involved in nucleolar targeting of nucleolin.Mol. Biol. Cell41239–1250. 10.1091/mbc.4.12.1239
41
DarriereT.JobetE.ZavalaD.EscandeM. L.DurutN.De BuresA.et al (2022). Upon heat stress processing of ribosomal RNA precursors into mature rRNAs is compromised after cleavage at primary P site in Arabidopsis thalian a.RNA Biol.19719–734. 10.1080/15476286.2022.2071517
42
DattaD.AnbarasuK.RajabatherS.PriyaR. S.DesaiP.MahalingamS. (2015). Nucleolar GTP-binding protein-1 (NGP-1) promotes G1 to S phase transition by activating cyclin-dependent kinase inhibitor p21 Cip1/Waf1.J. Biol. Chem.29021536–21552. 10.1074/jbc.M115.637280
43
DegenhardtR. F.Bonham-SmithP. C. (2008). Arabidopsis ribosomal proteins RPL23aA and RPL23aB Are differentially targeted to the nucleolus and are disparately required for normal development.Plant Physiol.147128–142. 10.1104/pp.107.111799
44
di BariM. G.CiuffiniL.MingardiM.TestiR.SodduS.BarilàD. (2006). c-Abl acetylation by histone acetyltransferases regulates its nuclear-cytoplasmic localization.EMBO Rep.7727–733. 10.1038/sj.embor.7400700
45
DingwallC.LaskeyR. A. (1991). Nuclear target sequences – a consensus?Trends Biochem. Sci.16478–481. 10.1016/0968-0004(91)90184-w
46
DingwallC.RobbinsJ.DilworthS. M.RobertsB.RichardsonW. D. (1988). The nucleoplasmin nuclear location sequence is larger and more complex than that of SV-40 large T antigen. J. Cell Biol.107, 841–849. 10.1083/jcb.107.3.841
47
Doron-MandelE.KoppelI.AbrahamO.RishalI.SmithT. P.BuchananC. N.et al (2021). The glycine arginine-rich domain of the RNA-binding protein nucleolin regulates its subcellular localization.EMBO J.40:e107158. 10.15252/embj.2020107158
48
DurutN.Sáez-VásquezJ. (2015). Nucleolin: Dual roles in rDNA chromatin transcription.Gene5567–12. 10.1016/j.gene.2014.09.023
49
EmeneckerR. J.HolehouseA. S.StraderL. C. (2020). Emerging roles for phase separation in plants.Dev. Cell5569–83. 10.1016/j.devcel.2020.09.010
50
EvrardA.KumarM.LecourieuxD.LucksJ.von Koskull-DöringP.HirtH. (2013). Regulation of the heat stress response in Arabidopsis by MPK6-targeted phosphorylation of the heat stress factor HsfA2.PeerJ1:e59. 10.7717/peerj.59
51
FangY.SpectorD. L. (2007). Identification of nuclear dicing bodies containing proteins for MicroRNA biogenesis in living Arabidopsis plants.Curr. Biol.17818–823. 10.1016/j.cub.2007.04.005
52
FangY.HearnS.SpectorD. L. (2004). Tissue-specific expression and dynamic organization of SR splicing factors in Arabidopsis.Mol. Biol. Cell152664–2673. 10.1091/mbc.e04-02-0100
53
FankhauserC.ChenM. (2008). Transposing phytochrome into the nucleus.Trends Plant Sci.13596–601. 10.1016/j.tplants.2008.08.007
54
Fernández-TorneroC.Moreno-MorcilloM.RashidU. J.TaylorN. M. I.RuizF. M.GrueneT.et al (2013). Crystal structure of the 14-subunit RNA polymerase i.Nature502644–649. 10.1038/nature12636
55
FischerU.HuberJ.BoelensW. C.MattajI. W.LührmannR. (1995). The HIV-1 rev activation domain is a nuclear export signal that accesses an export pathway used by specific cellular RNAs.Cell82475–483. 10.1016/0092-8674(95)90436-0
56
FongK. W.LiY.WangW.MaW.LiK.QiR. Z.et al (2013). Whole-genome screening identifies proteins localized to distinct nuclear bodies.J. Cell Biol.203149–164. 10.1083/jcb.201303145
57
FornerodM.OhnoM. (1997). CRM1 is an export receptor for leucine-rich nuclear export signals.Cell901051–1060. 10.1016/s0092-8674(00)80371-2
58
FreyM. R.MateraA. G. (1995). Coiled bodies contain U7 small nuclear RNA and associate with specific DNA sequences in interphase human cells.Proc. Natl. Acad. Sci. U.S.A.925915–5919. 10.1073/pnas.92.13.5915
59
Fromont-RacineM.SengerB.SaveanuC.FasioloF. (2003). Ribosome assembly in eukaryotes.Gene31317–42. 10.1016/S0378-1119(03)00629-2
60
FujiokaY.UtsumiM.OhbaY.WatanabeY. (2007). Location of a possible miRNA processing site in SmD3/SmB nuclear bodies in Arabidopsis.Plant Cell Physiol.481243–1253. 10.1093/pcp/pcm099
61
FukadaT.ShibataS.UedaT.SasakiK.ShimoidaY.Senda-MurataK.et al (2019). Characterization of nucleolar localization and exclusion signals in terminal deoxynucleotidyltransferase interacting factor 2/estrogen receptor a-binding protein.Biosci. Biotechnol. Biochem.831255–1262. 10.1080/09168451.2019.1591265
62
FüßlM.LassowskatI.NéeG.KoskelaM. M.BrünjeA.TilakP.et al (2018). Beyond histones: New substrate proteins of lysine deacetylases in Arabidopsis nuclei.Front. Plant Sci.9:461. 10.3389/fpls.2018.00461
63
Gaete-ArgelA.VelásquezF.MárquezC. L.Rojas-ArayaB.Bueno-NietoC.Marín-RojasJ.et al (2021). Tellurite promotes stress granules and nuclear SG-like assembly in response to oxidative stress and DNA damage.Front. Cell Dev. Biol.9:622057. 10.3389/fcell.2021.622057
64
GallardoP.Real-CalderónP.Flor-ParraI.Salas-PinoS.DagaR. R. (2020). Acute heat stress leads to reversible aggregation of nuclear proteins into nucleolar rings in fission yeast.Cell Rep.33:108377. 10.1016/j.celrep.2020.108377
65
GallardoP.Salas-PinoS.DagaR. R. (2021). Reversible protein aggregation as cytoprotective mechanism against heat stress.Curr. Genet.67849–855. 10.1007/s00294-021-01191-2
66
GhuleP. N.DominskiZ.YangX. C.MarzluffW. F.BeckerK. A.HarperJ. W.et al (2008). Staged assembly of histone gene expression machinery at subnuclear foci in the abbreviated cell cycle of human embryonic stem cells.Proc. Natl. Acad. Sci. U.S.A.10516964–16969. 10.1073/pnas.0809273105
67
GinistyH.SicardH.RogerB.BouvetP. (1999). Structure and functions of nucleolin.J. Cell Sci.112761–772. 10.1242/jcs.112.6.761
68
GuddatU.BakkenA. H.PielerT. (1990). Protein-mediated nuclear export of RNA: 5S rRNA containing small RNPs in Xenopus oocytes.Cell60619–628. 10.1016/0092-8674(90)90665-2
69
GuilfoyleT. J.DietrichM. A. (1987). “Plant RNA polymerases: Structures, regulation, and genes,” in Tailoring genes for crop improvement. Basic life sciences, edsBrueningG.HaradaJ.KosugeT.HollaenderA.KunyG.WilsonC. M. (Berlin: Springer), 87–100. 10.1007/978-1-4684-5329-4_8
70
GuoM.LiuJ. H.MaX.LuoD. X.GongZ. H.LuM. H. (2016). The plant heat stress transcription factors (HSFs): Structure, regulation, and function in response to abiotic stresses.Front. Plant Sci.7:114. 10.3389/fpls.2016.00114
71
GuoT.FangY. (2014). Functional organization and dynamics of the cell nucleus.Front. Plant Sci.5:378. 10.3389/fpls.2014.00378
72
HaagJ. R.PikaardC. S. (2007). RNA polymerase I: A multifunctional molecular machine.Cell1311224–1225. 10.1016/j.cell.2007.12.005
73
HaasenD.KoC.HlerÈNeuhausG.MerkleT. (1999). Nuclear export of proteins in plants: AtXPO1 is the export receptor for leucine-rich nuclear export signals in Arabidopsis thaliana.Plant J.20695–705. 10.1046/j.1365-313x.1999.00644.x
74
HahmJ.KimK.QiuY.ChenM. (2020). Increasing ambient temperature progressively disassemble Arabidopsis phytochrome B from individual photobodies with distinct thermostabilities.Nat. Commun.11:1660. 10.1038/s41467-020-15526-z
75
HallM. N.HerefordL.HerskowitzI. (1984). Targeting of E. coli β-galactosidase to the nucleus in yeast.Cell361057–1065. 10.1016/0092-8674(84)90055-2
76
HannounZ.GreenhoughS.JaffrayE.HayR. T.HayD. C. (2010). Post-translational modification by SUMO.Toxicology278288–293. 10.1016/j.tox.2010.07.013
77
HayashiK.MatsunagaS. (2019). Heat and chilling stress induce nucleolus morphological changes.J. Plant Res.132395–403. 10.1007/s10265-019-01096-9
78
HebertM. D.MateraA. G. (2000). Self-association of coilin reveals a common theme in nuclear body localization.Mol. Biol. Cell114159–4171. 10.1091/mbc.11.12.4159
79
HicksC. R.SmithH. M. S.ShiehM.RaikhelN. V. (1995). Three classes of nuclear import signals bind to plant nuclei.Plant Physiol.1071055–1058. 10.1104/pp.107.4.1055
80
HicksG. R. (2013). Nuclear import of plant proteins,” in madame curie bioscience database.Austin, TX: Landes Bioscience.
81
HirakawaT.MatsunagaS. (2019). Characterization of DNA repair foci in root cells of Arabidopsis in response to DNA damage.Front. Plant Sci.10:990. 10.3389/fpls.2019.00990
82
HirayamaS.SugiharaM.MoritoD.IemuraS. I.NatsumeT.MurataS.et al (2018). Nuclear export of ubiquitinated proteins via the UBIN-POST system.Proc. Natl. Acad. Sci. U.S.A.115E4199–E4208. 10.1073/pnas.1711017115
83
HsuS. F.LaiH. C.JinnT. L. (2010). Cytosol-localized heat shock factor-binding protein, AtHSBP, Functions as a negative regulator of heat shock response by translocation to the nucleus and is required for seed development in Arabidopsis.Plant Physiol.153773–784. 10.1104/pp.109.151225
84
HuangX.ZhangQ.JiangY.YangC.WangQ. (2018). Shade-induced nuclear localization of PIF7 is regulated by phosphorylation and 14-3- 3 proteins in Arabidopsis.Elife7:e31636. 10.7554/eLife.31636
85
HübnerS.SmithH. M.HuW.Kai ChanC.RihsH. P.PaschalB. M.et al (1999). Plant importin binds nuclear localization sequences with high affinity and can mediate nuclear import independent of importin β.J. Biol. Chem.27422610–22617. 10.1074/jbc.274.32.22610
86
JäkelS.GörlichD. (1998). Importin β, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells.EMBO J.174491–4502. 10.1093/emboj/17.15.4491
87
JordanE. G. (1984). Nucleolar nomenclature.J. Cell Sci.67217–220. 10.1242/jcs.67.1.217
88
JungJ. H.BarbosaA. D.HutinS.KumitaJ. R.GaoM.DerwortD.et al (2020). A prion-like domain in ELF3 functions as a thermosensor in Arabidopsis.Nature585256–260. 10.1038/s41586-020-2644-7
89
KaganovichD.KopitoR.FrydmanJ. (2008). Misfolded proteins partition between two distinct quality control compartments.Nature4541088–1095. 10.1038/nature07195
90
KaiserT. E.IntineR. V.DundrM. (2008). De novo formation of a subnuclear body.Science3221713–1717. 10.1126/science.1165216
91
KalderonD.RobertsB. L.RichardsonW. D.SmithA. E. (1984). A short amino acid sequence able to specify nuclear location.Cell39499–509. 10.1016/0092-8674(84)90457-4
92
KannanK.NelsonA. D. L.ShippenD. E. (2008). Dyskerin is a component of the Arabidopsis telomerase RNP required for telomere maintenance.Mol. Cell. Biol.282332–2341. 10.1128/mcb.01490-07
93
KannoT.LinW. D.FuJ. L.WuM. T.YangH. W.LinS. S.et al (2016). Identification of coilin mutants in a screen for enhanced expression of an alternatively spliced GFP reporter gene in Arabidopsis thaliana.Genetics2031709–1720. 10.1534/genetics.116.190751
94
KarpenG. H.SchaeferJ. E.LairdC. D. (1988). A Drosophila rRNA gene located in euchromatin is active in transcription and nucleolus formation.Genes Dev.21745–1763. 10.1101/gad.2.12b.1745
95
KehlenbachR. H.DickmannsA.GeraceL. (1998). Nucleocytoplasmic shuttling factors including ran and CRM1 Mediate nuclear export of NFAT in vitro.J. Cell Biol.141863–874. 10.1083/jcb.141.4.863
96
KimK.DimitrovaD. D.CartaK. M.SaxenaA.DarasM.BorowiecJ. A. (2005). Novel checkpoint response to genotoxic stress mediated by nucleolin-replication protein a complex formation.Mol. Cell. Biol.252463–2474. 10.1128/mcb.25.6.2463-2474.2005
97
KimL.KircherS.TothR.AdamE.SchäferE.NagyF. (2000). Light-induced nuclear import of phytochrome-A:GFP fusion proteins is differentially regulated in transgenic tobacco and Arabidopsis.Plant J.22125–133. 10.1046/j.1365-313X.2000.00729.x
98
KimS. H.SpensleyM.ChoiS. K.CalixtoC. P. G.PendleA. F.KorolevaO.et al (2010). Plant U13 orthologues and orphan snoRNAs identified by RNomics of RNA from Arabidopsis nucleoli.Nucleic Acids Res.383054–3067. 10.1093/nar/gkp1241
99
KircherS.Kozma-BognarL.KimL.AdamE.HarterK.SchäferE.et al (1999). Light Quality-dependent nuclear import of the plant photoreceptors phytochrome A and B.Plant Cell111445–1456. 10.1105/tpc.11.8.1445
100
KitsiosG.AlexiouK. G.BushM.ShawP.DoonanJ. H. (2008). A cyclin-dependent protein kinase, CDKC2, colocalizes with and modulates the distribution of spliceosomal components in Arabidopsis.Plant J.54220–235. 10.1111/j.1365-313X.2008.03414.x
101
KondohK.TerasawaK.MorimotoH.NishidaE. (2006). Regulation of Nuclear translocation of extracellular signal-regulated kinase 5 by active nuclear import and export mechanisms.Mol. Cell. Biol.261679–1690. 10.1128/MCB.26.5.1679-1690.2006
102
KorgaonkarC.HagenJ.TompkinsV.FrazierA. A.AllamargotC.QuelleF. W.et al (2005). Nucleophosmin (B23) targets ARF to nucleoli and inhibits its function.Mol. Cell. Biol.251258–1271. 10.1128/mcb.25.4.1258-1271.2005
103
KorostelevA.NollerH. F. (2007). The ribosome in focus: New structures bring new insights.Trends Biochem. Sci.32434–441. 10.1016/j.tibs.2007.08.002
104
KosugiS.YanagawaH.TerauchiR.TabataS. (2014). NESmapper: Accurate Prediction of leucine-rich nuclear export signals using activity-based profiles.PLoS Comput. Biol.10:e1003841. 10.1371/journal.pcbi.1003841
105
KurzbauerM. T.UanschouC.ChenD.SchlögelhoferP. (2012). The recombinases DMC1 and RAD51 are functionally and spatially separated during meiosis in Arabidopsis.Plant Cell242058–2070. 10.1105/tpc.112.098459
106
KutayU.BischoffF. R. (1997). Export of importin from the nucleus is mediated by a specific nuclear transport factor.Cell901061–1071. 10.1016/s0092-8674(00)80372-4
107
LafontaineD. L. J.RibackJ. A.BascetinR.BrangwynneC. P. (2021). The nucleolus as a multiphase liquid condensate.Nat. Rev. Mol. Cell Biol.22165–182. 10.1038/s41580-020-0272-6
108
LamondA. I.SpectorD. L. (2003). Nuclear speckles: A model for nuclear organelles.Nat. Rev. Mol. Cell Biol.4605–612. 10.1038/nrm1172
109
LangJ.SmetanaO.Sanchez-CalderonL.LinckerF.GenestierJ.SchmitA. C.et al (2012). Plant γH2AX foci are required for proper DNA DSB repair responses and colocalize with E2F factors.New Phytol.194353–363. 10.1111/j.1469-8137.2012.04062.x
110
LangeA.McLaneL. M.MillsR. E.DevineS. E.CorbettA. H. (2010). Expanding the definition of the classical bipartite nuclear localization signal.Traffic11311–323. 10.1111/j.1600-0854.2009.01028.x
111
LeckerS. H.GoldbergA. L.MitchW. E. (2006). Protein degradation by the ubiquitin-proteasome pathway in normal and disease states.J. Am. Soc. Nephrol.171807–1819. 10.1681/ASN.2006010083
112
LegrisM.KloseC.BurgieE. S.RojasC. C.NemeM.HiltbrunnerA.et al (2016). Phytochrome B integrates light and temperature signals in Arabidopsis.Science354897–900. 10.1126/science.aaf5656
113
LeungA. K. L.AndersenJ. S.MannM.LamondA. I. (2003). Bioinformatic analysis of the nucleolus.Biochem. J.376553–569. 10.1042/BJ20031169
114
LiC. F.HendersonI. R.SongL.FedoroffN.LagrangeT.JacobsenS. E. (2008). Dynamic regulation of ARGONAUTE4 within multiple nuclear bodies in Arabidopsis thaliana.PLoS Genet.4:e27. 10.1371/journal.pgen.0040027
115
LiC. F.PontesO.El-ShamiM.HendersonI. R.BernatavichuteY. V.ChanS. W. L.et al (2006). An ARGONAUTE4-containing nuclear processing center colocalized with cajal bodies in Arabidopsis thaliana.Cell12693–106. 10.1016/j.cell.2006.05.032
116
LiJ.KinoshitaT.PandeyS.NgC. K.-Y.GygiS. P.ShimazakiK.et al (2002). Modulation of an RNA-binding protein by abscisic-acid-activated protein kinase.Nature418793–797. 10.1038/nature00936
117
LinY. T.YenP. H. (2006). A novel nucleocytoplasmic shuttling sequence of DAZAP1, a testis-abundant RNA-binding protein.RNA121486–1493. 10.1261/rna.42206
118
LiuJ. L.MurphyC.BuszczakM.ClatterbuckS.GoodmanR.GallJ. G. (2006). The Drosophila melanogaster Cajal body.J. Cell Biol.172875–884. 10.1083/jcb.200511038
119
LiuJ.-L.WuZ.NizamiZ.DeryushevaS.RajendraT. K.BeumerK. J.et al (2009). Coilin Is essential for cajal body organization in Drosophila melanogaster.Mol. Biol. Cell201661–1670. 10.1091/mbc.E08-05-0525
120
LiuQ.ShiL.FangY. (2012). Dicing bodies.Plant Physiol.15861–66. 10.1104/pp.111.186734
121
LiuY.LinG.YinC.FangY. (2020). B-box transcription factor 28 regulates flowering by interacting with constans.Sci. Rep.10:11789. 10.1038/s41598-020-74445-7
122
LiuY.LiuQ.YanQ.ShiL.FangY. (2014). Nucleolus-tethering system (NoTS) reveals that assembly of photobodies follows a self-organization model.Mol. Biol. Cell251366–1373. 10.1091/mbc.E13-09-0527
123
LiuZ.JiaY.DingY.ShiY.LiZ.GuoY.et al (2017). Plasma membrane CRPK1-mediated phosphorylation of 14-3-3 proteins induces their nuclear import to fine-tune CBF signaling during cold response.Mol. Cell66117.e–128.e. 10.1016/j.molcel.2017.02.016
124
LöbrichM.ShibataA.BeucherA.FisherA.EnsmingerM.GoodarziA. A.et al (2010). gammaH2AX foci analysis for monitoring DNA double-strand break repair: Strengths, limitations and optimization.Cell Cycle9662–669. 10.4161/cc.9.4.10764
125
LorkoviæZ. J.HilscherJ.BartaA. (2008). Co-localisation studies of Arabidopsis SR splicing factors reveal different types of speckles in plant cell nuclei.Exp. Cell Res.3143175–3186. 10.1016/j.yexcr.2008.06.020
126
LorkoviæZ. J.LopatoS.PexaM.LehnerR.BartaA. (2004). Interactions of Arabidopsis RS domain containing cyclophilins with SR proteins and U1 and U11 small nuclear ribonucleoprotein-specific proteins suggest their involvement in Pre-mRNA splicing.J. Biol. Chem.27933890–33898. 10.1074/jbc.M400270200
127
LoveA. J.YuC.PetukhovaN. V.KalininaN. O.ChenJ.TalianskyM. E. (2017). Cajal bodies and their role in plant stress and disease responses.RNA Biol.14779–790. 10.1080/15476286.2016.1243650
128
LuJ.WuT.ZhangB.LiuS.SongW.QiaoJ.et al (2021). Types of nuclear localization signals and mechanisms of protein import into the nucleus.Cell Commun. Signal.19:60. 10.1186/s12964-021-00741-y
129
LunnJ. E. (2007). Compartmentation in plant metabolism.J. Exp. Bot.5835–47. 10.1093/jxb/erl134
130
MaceluchJ.KmieciakM.Szweykowska-KuliñskaZ.JarmoowskiA. (2001). Cloning and characterization of Arabidopsis thaliana AtNAP57 — a homologue of yeast pseudouridine synthase Cbf5p.Acta Biochim. Pol.48699–709.
131
MakarovV.RakitinaD.ProtopopovaA.YaminskyI.ArutiunianA.LoveA. J.et al (2013). Plant coilin: Structural characteristics and RNA-binding properties.PLoS One8:e53571. 10.1371/journal.pone.0053571
132
MalletP. L.BachandF. (2013). A Proline-Tyrosine nuclear localization signal (PY-NLS) is required for the nuclear import of fission yeast PAB2, but not of human PABPN1.Traffic14282–294. 10.1111/tra.12036
133
MaoY. S.ZhangB.SpectorD. L. (2011). Biogenesis and function of nuclear bodies.Trends Genet.27295–306. 10.1016/j.tig.2011.05.006
134
MartinR. M.Ter-AvetisyanG.HerceH. D.LudwigA. K.Lättig-TünnemannG.CardosoM. C. (2015). Principles of protein targeting to the nucleolus.Nucleus6314–325. 10.1080/19491034.2015.1079680
135
MartoglioB.DobbersteinB. (1998). Signal sequences: More than just greasy peptides.Trends Cell Biol.8410–415. 10.1016/S0962-8924(98)01360-9
136
Maruri-LópezI.FigueroaN. E.Hernández-SánchezI. E.ChodasiewiczM. (2021). Plant stress granules: Trends and beyond.Front. Plant Sci.12:722643. 10.3389/fpls.2021.722643
137
MateraA. G.Izaguire-sierraM.PraveenK.RajendraT. K. (2011). Nuclear bodies: Random aggregates of sticky proteins or crucibles of macromolecular assembly?Dev. Cell17639–647. 10.1016/j.devcel.2009.10.017
138
MatsukiR.IwasakiT.ShojiK.JiangC.-J.YamamotoN. (1998). Isolation and characterization of two importin β genes from rice.Plant Cell Physiol.39879–884. 10.1093/oxfordjournals.pcp.a029448
139
MatsushitaT.MochizukiN.NagataniA. (2003). Dimers of the N-terminal domain of phytochrome B are functional in the nucleus.Nature424571–574. 10.1038/nature01837
140
MatsuuraY.StewartM. (2005). Nup50/Npap60 function in nuclear protein import complex disassembly and importin recycling.EMBO J.243681–3689. 10.1038/sj.emboj.7600843
141
MekhailK.Rivero-LopezL.Al-MasriA.BrandonC.KhachoM.LeeS. (2007). Identification of a common subnuclear localization signal.Mol. Biol. Cell183966–3977. 10.1091/mbc.E07-03-0295
142
MélèseT.XueZ. (1995). The nucleolus: An organelle formed by the act of building a ribosome.Curr. Opin. Cell Biol.7319–324. 10.1016/0955-0674(95)80085-9
143
MengL.ZhuQ.TsaiR. Y. L. (2007). Nucleolar trafficking of nucleostemin family proteins: Common versus protein-specific mechanisms.Mol. Cell. Biol.278670–8682. 10.1128/mcb.00635-07
144
MichaelW. M. (2000). Nucleocytoplasmic shuttling signals: Two for the price of one.Trends Cell Biol.1046–50. 10.1016/s0962-8924(99)01695-5
145
MontaciéC.DurutN.OpsomerA.PalmD.ComellaP.PicartC.et al (2017). Nucleolar proteome analysis and proteasomal activity assays reveal a link between nucleolus and 26S proteasome in A. thaliana.Front. Plant Sci.8:1815. 10.3389/fpls.2017.01815
146
NagataniA. (2010). Phytochrome: Structural basis for its functions.Curr. Opin. Plant Biol.13565–570. 10.1016/j.pbi.2010.07.002
147
NardozziJ. D.LottK.CingolaniG. (2010). Phosphorylation meets nuclear import: A review.Cell Commun. Signal.8:32. 10.1186/1478-811X-8-32
148
NémethA.LängstG. (2011). Genome organization in and around the nucleolus.Trends Genet.27149–156. 10.1016/j.tig.2011.01.002
149
NevilleM.StutzF.LeeL.DavisL. I.RosbashM. (1997). The importin-beta family member Crm1p bridges the interaction between Rev and the nuclear pore complex during nuclear export.Curr. Biol.7767–775. 10.1016/s0960-9822(06)00335-6
150
Nguyen BaA. N.PogoutseA.ProvartN.MosesA. M. (2009). NLStradamus: A simple Hidden markov model for nuclear localization signal prediction.BMC Bioinformatics10:202. 10.1186/1471-2105-10-202
151
NiedojadłoJ.KubickaE.KalichB.SmoliñskiD. J. (2014). Poly(A) RNAs including coding proteins RNAs occur in plant cajal bodies.PLoS One9:e111780. 10.1371/journal.pone.0111780
152
NiggE. A. (1997). Nucleocytoplasmic transport: Signals, mechanisms and regulation.Nature386779–787. 10.1038/386779a0
153
NisaM. U.HuangY.BenhamedM.RaynaudC. (2019). The plant DNA damage response: Signaling pathways leading to growth inhibition and putative role in response to stress conditions.Front. Plant Sci.10:653. 10.3389/fpls.2019.00653
154
NizamiZ.DeryushevaS.GallJ. G. (2010). The cajal body and histone locus body.Cold Spring Harb. Perspect. Biol.2:a000653. 10.1101/cshperspect.a000653
155
OchsR. L.LischweM. A.ShenE.CarrollR. E.BuschH. (1985). Nucleologenesis: Composition and fate of prenucleolar bodies.Chromosoma92330–336. 10.1007/BF00327463
156
OggS. C.LamondA. I. (2002). Cajal bodies and coilin – moving towards function.J. Cell Biol.15917–21. 10.1083/jcb.200206111
157
OkuwakiM.Saotome-YoshimuraA.MasashiN.SaitoS.SekiyaH. H.-M. T.NagataK. (2021). RNA-recognition motifs and glycine and arginine-rich region cooperatively regulate the nucleolar localization of nucleolin.J. Biochem.16987–100. 10.1093/jb/mvaa095
158
Ossareh-NazariB.BacherieF.DargemontC. (1997). Evidence for a role of CRM1 in signal-mediated nuclear protein export.Science278141–144. 10.1126/science.278.5335.141
159
OudhoffM. J.FreemanS. A.CouzensA. L.AntignanoF.KuznetsovaE.MinP. H.et al (2013). Control of the hippo pathway by Set7-dependent methylation of yap.Dev. Cell26188–194. 10.1016/j.devcel.2013.05.025
160
PadekenJ.HeunP. (2014). Nucleolus and nuclear periphery: Velcro for heterochromatin.Curr. Opin. Cell Biol.2854–60. 10.1016/j.ceb.2014.03.001
161
PalmD.SimmS.DarmK.WeisB. L.RuprechtM.SchleiffE.et al (2016). Proteome distribution between nucleoplasm and nucleolus and its relation to ribosome biogenesis in Arabidopsis thaliana.RNA Biol.13441–454. 10.1080/15476286.2016.1154252
162
PellarG. J.DiMarioP. J. (2003). Deletion and site-specific mutagenesis of nucleolin’s carboxy GAR domain.Chromosoma111461–469. 10.1007/s00412-003-0231-y
163
PendleA. F.ClarkG. P.BoonR.LewandowskaD.LamY. W.AndersenJ.et al (2005). Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.Mol. Biol. Cell16260–269. 10.1091/mbc.e04-09-0791
164
PetrovskáB.ŠebelaM.DoleželJ. (2015). Inside a plant nucleus: Discovering the proteins.J. Exp. Bot.661627–1640. 10.1093/jxb/erv041
165
Picart-PicoloA.PicartC.PicaultN.PontvianneF. (2020). Nucleolus-associated chromatin domains are maintained under heat stress, despite nucleolar reorganization in Arabidopsis thaliana.J. Plant Res.133463–470. 10.1007/s10265-020-01201-3
166
PihK. T.YiM. J.LiangY. S.ShinB. J.ChoM. J.HwangI.et al (2000). Molecular cloning and targeting of a fibrillarin homolog from Arabidopsis.Plant Physiol.12351–58. 10.1104/pp.123.1.51
167
PontesO.PikaardC. S. (2008). siRNA and miRNA processing: New functions for Cajal bodies.Curr. Opin. Genet. Dev.18197–203. 10.1016/j.gde.2008.01.008
168
PontvianneF.CarpentierM. C.DurutN.PavlištováV.JaškeK.SchoøováŠet al (2016). Identification of nucleolus-associated chromatin domains reveals a role for the nucleolus in 3D organization of the A. thaliana genome.Cell Rep.161574–1587. 10.1016/j.celrep.2016.07.016
169
PontvianneF.MatíaI.DouetJ.Sylvette TourmenteF. J. M.EcheverriaM.Saéz-VásquezJ. (2007). Characterization of AtNUC-L1 reveals a central role of nucleolin in nucleolus organization and silencing of AtNUC-L2 Gene in Arabidopsis.Mol. Biol. Cell18369–379. 10.1091/mbc.E06-08-0751
170
PorterF. W.PalmenbergA. C. (2009). Leader-induced phosphorylation of nucleoporins correlates with nuclear trafficking inhibition by cardioviruses.J. Virol.831941–1951. 10.1128/jvi.01752-08
171
RamaziS.ZahiriJ. (2021). Post-translational modifications in proteins: Resources, tools and prediction methods.Database (Oxford).2021:baab012. 10.1093/database/baab012
172
RausinG.TillemansV.StankovicN.HanikenneM.MotteP. (2010). Dynamic Nucleocytoplasmic shuttling of an Arabidopsis Sr splicing factor: Role of the RNA-binding domains.Plant Physiol.153273–284. 10.1104/pp.110.154740
173
ReamT. S.HaagJ. R.PontvianneF.NicoraC. D.NorbeckA. D.Paša-ToliæL.et al (2015). Subunit compositions of Arabidopsis RNA polymerases I and III reveal Pol I- and Pol III-specific forms of the AC40 subunit and alternative forms of the C53 subunit.Nucleic Acids Res.434163–4178. 10.1093/nar/gkv247
174
ReddyA. S. N.DayI. S.GöhringJ.BartaA. (2012). Localization and dynamics of nuclear speckles in plants.Plant Physiol.15867–77. 10.1104/pp.111.186700
175
RenY.LiY.JiangY.WuB.MiaoY. (2017). Phosphorylation of WHIRLY1 by CIPK14 shifts its localization and dual functions in Arabidopsis.Mol. Plant10749–763. 10.1016/j.molp.2017.03.011
176
RibbeckK.LipowskyG.KentH. M.StewartM.Gö RlichD. (1998). NTF2 mediates nuclear import of Ran.EMBO J.176587–6598. 10.1093/emboj/17.22.6587
177
RockwellN. C.SuY. S.LagariasJ. C. (2006). Phytochrome structure and signaling mechanisms.Annu. Rev. Plant Biol.57837–858. 10.1146/annurev.arplant.56.032604.144208
178
RogerB.MoisandA.AmalricF.BouvetP. (2003). Nucleolin provides a link between RNA polymerase I transcription and pre-ribosome assembly.Chromosoma111399–407. 10.1007/s00412-002-0221-5
179
RothenbuschU.SawatzkiM.ChangY.CaesarS.SchlenstedtG. (2012). Sumoylation regulates Kap114-mediated nuclear transport.EMBO J.312461–2472. 10.1038/emboj.2012.102
180
RowlandR. R. R.YooD. (2003). Nucleolar-cytoplasmic shuttling of PRRSV nucleocapsid protein: A simple case of molecular mimicry or the complex regulation by nuclear import, nucleolar localization and nuclear export signal sequences.Virus Res.9523–33. 10.1016/s0168-1702(03)00161-8
181
RyuH.KimK.ChoH.ParkJ.ChoeS.HwangI. (2007). Nucleocytoplasmic shuttling of BZR1 Mediated by phosphorylation is essential in Arabidopsis brassinosteroid signaling.Plant Cell192749–2762. 10.1105/tpc.107.053728
182
Sáez-VásquezJ.DelsenyM. (2019). Ribosome biogenesis in plants: From functional 45S ribosomal DNA organization to ribosome assembly factors.Plant Cell311945–1967. 10.1105/tpc.18.00874
183
Sáez-VásquezJ.GadalO. (2010). Genome organization and function: A view from Yeast and Arabidopsis.Mol. Plant3678–690. 10.1093/mp/ssq034
184
Sáez-VásquezJ.MedinaF. J. (2008). “The plant nucleolus,” in Advances in botanical research, edsKaderJ. C.DelsenyM. (San Diego, CA: Elsevier), 1–46. 10.1016/S0065-2296(08)00001-3
185
Sáez-VásquezJ.GalloisP.DelsenyM. (2000). Accumulation and nuclear targeting of BnC24, a Brassica napus ribosomal protein corresponding to a mRNA accumulating in response to cold treatment.Plant Sci.15635–46. 10.1016/s0168-9452(00)00229-6
186
SaraccoS. A.MillerM. J.KurepaJ.VierstraR. D. (2007). Genetic analysis of SUMOylation in Arabidopsis: Conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.Plant Physiol.145119–134. 10.1104/pp.107.102285
187
SazerS.DassoM. (2000). The ran decathlon: Multiple roles of ran.J. Cell Sci.1131111–1118. 10.1242/jcs.113.7.1111
188
SchâferE.MarchalB.MarméD. (1972). In vivo measurements of the phytochrome photostationary state in far red light.Photochem. Photobiol.15457–464. 10.1111/j.1751-1097.1972.tb06257.x
189
SchmidF. X. (1995). Protein folding. Prolyl isomerases join the fold.Curr. Biol.5993–994. 10.1016/S0960-9822(95)00197-7
190
Schmidt-ZachmannM. S.NiggE. A. (1993). Protein localization to the nucleolus: A search for targeting domains in nucleolin.J. Cell Sci.105799–806. 10.1242/jcs.105.3.799
191
ScottM. S.BoisvertF. M.McDowallM. D.LamondA. I.BartonG. J. (2010). Characterization and prediction of protein nucleolar localization sequences.Nucleic Acids Res.387388–7399. 10.1093/nar/gkq653
192
ScottM. S.TroshinP. V.BartonG. J. (2011). NoD: A Nucleolar localization sequence detector for eukaryotic and viral proteins.BMC Bioinformatics12:317. 10.1186/1471-2105-12-317
193
ShiehM. W.WesslerS. R.RaikhelN. V. (1993). Nuclear Targeting of the maize r protein requires two nuclear localization sequences.Plant Physiol.101353–361. 10.1104/pp.101.2.353
194
ShubinaM. Y.ArifulinE. A.SorokinD. V.SosinaM. A.TikhomirovaM. A.SerebryakovaM. V.et al (2020). The GAR domain integrates functions that are necessary for the proper localization of fibrillarin (FBL) inside eukaryotic cells.PeerJ8:e9029. 10.7717/peerj.9029
195
SinghG.BatzenschlagerM.TomkovaD.HerzogE.HoffmannE.HoulnéG.et al (2022). GIP1 and GIP2 contribute to the maintenance of genome stability at the nuclear periphery.Front. Plant Sci.12:804928. 10.3389/fpls.2021.804928
196
SinghH.KaurK.SinghM.KaurG. (2020). Plant cyclophilins: Multifaceted proteins with versatile roles.Front. Plant Sci.11:585212. 10.3389/fpls.2020.585212
197
SiomiH.DreyfussG. (1995). A nuclear localization domain in the hnRNP A1 protein.J. Cell Biol.129551–560. 10.1083/jcb.129.3.551
198
SirriV.Urcuqui-InchimaS.RousselP.Hernandez-VerdunD. (2008). Nucleolus: The fascinating nuclear body.Histochem. Cell Biol.12913–31. 10.1007/s00418-007-0359-6
199
SleemanJ. E.Trinkle-MulcahyL. (2014). Nuclear bodies: New insights into assembly/dynamics and disease relevance.Curr. Opin. Cell Biol.2876–83. 10.1016/j.ceb.2014.03.004
200
SloanK. E.WardaA. S.SharmaS.EntianK. D.LafontaineD. L. J.BohnsackM. T. (2017). Tuning the ribosome: The influence of rRNA modification on eukaryotic ribosome biogenesis and function.RNA Biol.141138–1152. 10.1080/15476286.2016.1259781
201
SmithA.BrownawellA.MacaraI. G. (1998). Nuclear import of ran is mediated by the transport factor NTF2.Curr. Biol.81403–1406. 10.1016/s0960-9822(98)00023-2
202
SmithH. M.HicksG. R.RaikhelN. V. (1995). lmportin a from Arabidopsis thaliana 1s a nuclear lmport receptor that recognizes three classes of lmport signals.Plant Physiol.114411–417. 10.1104/pp.114.2.411
203
SnaarS.WiesmeijerK.JochemsenA. G.TankeH. J.DirksR. W. (2000). Mutational analysis of fibrillarin and its mobility in living human cells.J. Cell Biol.151653–662. 10.1083/jcb.151.3.653
204
SolymosiK.SchoefsB. (2019). Plant cell compartments.Bot. Lett.166269–273. 10.1080/23818107.2019.1652851
205
SongL.HanM. H.LesickaJ.FedoroffN. (2007). Arabidopsis primary microRNA processing proteins HYL1 and DCL1 define a nuclear body distinct from the Cajal body.Proc. Natl. Acad. Sci. U.S.A.1045437–5442. 10.1073/pnas.0701061104
206
SpectorD. L.LamondA. I. (2011). Nuclear speckles.Cold Spring Harb. Perspect. Biol.3:a000646. 10.1101/cshperspect.a000646
207
StaceyM. G.Von ArnimA. G. (1999). A novel motif mediates the targeting of the Arabidopsis COP1 protein to subnuclear foci.J. Biol. Chem.27427231–27236. 10.1074/jbc.274.38.27231
208
StewartM. (2007). Molecular mechanism of the nuclear protein import cycle.Nat. Rev. Mol. Cell Biol.8195–208. 10.1038/nrm2114
209
StrzeleckaM.TrowitzschS.WeberG.LührmannR.OatesA. C.NeugebauerK. M. (2010). Coilin-dependent snRNP assembly is essential for zebrafish embryogenesis.Nat. Struct. Mol. Biol.17403–409. 10.1038/nsmb.1783
210
StutzF.IzaurraldeE.MattajI. W.RosbashA. M. (1996). A role for nucleoporin FG repeat domains in export of human immunodeficiency virus type 1 rev protein and RNA from the nucleus.Mol. Cell. Biol.167144–7150. 10.1128/mcb.16.12.7144
211
SuzukiT.IzumiH.OhnoM. (2010). Cajal body surveillance of U snRNA export complex assembly.J. Cell Biol.190603–612. 10.1083/jcb.201004109
212
TaddeiA.HedigerF.NeumannF. R.GasserS. M. (2004). The function of nuclear architecture: A genetic approach.Annu. Rev. Genet.38305–345. 10.1146/annurev.genet.37.110801.142705
213
TajrishiM. M.TutejaR.TutejaN. (2011). Nucleolin.Commun. Integr. Biol.4267–275. 10.4161/cib.4.3.14884
214
TakagiM.AbsalonM. J.McLureK. G.KastanM. B. (2005). Regulation of p53 translation and induction after DNA damage by ribosomal protein L26 and nucleolin.Cell12349–63. 10.1016/j.cell.2005.07.034
215
TamuraK.Hara-NishimuraI. (2014). Functional insights of nucleocytoplasmic transport in plants.Front. Plant Sci.5:118. 10.3389/fpls.2014.00118
216
TangH.McDonaldD.MiddlesworthT.HopeT. J.Wong-StaalF. (1999). The carboxyl terminus of RNA helicase A contains a bidirectional nuclear transport domain.Mol. Cell. Biol.193540–3550. 10.1128/MCB.19.5.3540
217
TanevaS. G.LeeJ. M. C.CornellR. B. (2012). The amphipathic helix of an enzyme that regulates phosphatidylcholine synthesis remodels membranes into highly curved nanotubules. Biochim. Biophys. Acta – Biomembr. 1818, 1173–1186. 10.1016/j.bbamem.2012.01.006
218
TaokaM.NobeY.YamakiY.SatoK.IshikawaH.IzumikawaK.et al (2018). Landscape of the complete RNA chemical modifications in the human 80S ribosome.Nucleic Acids Res.469289–9298. 10.1093/nar/gky811
219
TillemansV.DispaL.RemacleC.CollingeM.MotteP. (2005). Functional distribution and dynamics of Arabidopsis SR splicing factors in living plant cells.Plant J.41567–582. 10.1111/j.1365-313X.2004.02321.x
220
TimneyB. L.RavehB.MironskaR.TrivediJ. M.KimS. J.RusselD.et al (2016). Simple rules for passive diffusion through the nuclear pore complex.J. Cell Biol.21557–76. 10.1083/jcb.201601004
221
Trinkle-MulcahyL. (2009). Aberrant mRNA transcripts and nonsense-mediated decay.F1000 Biol. Rep.1:93. 10.3410/b1-93
222
TrotmanL. C.WangX.AlimontiA.ChenZ.YangJ. T. F. H.PavletichN. P.et al (2007). Ubiquitination regulates PTEN nuclear import and tumor suppression.Cell128141–156. 10.1016/j.cell.2006.11.040
223
TuckerK. E.BercianoM. T.JacobsE. Y.LePageD. F.ShpargelK. B.RossireJ. J.et al (2001). Residual Cajal bodies in coilin knockout mice fail to recruit Sm snRNPs and SMN, the spinal muscular atrophy gene product.J. Cell Biol.154293–307. 10.1083/jcb.200104083
224
van BuskirkE. K.DeckerP. V.ChenM. (2012). Photobodies in light signaling.Plant Physiol.15852–60. 10.1104/pp.111.186411
225
WalkerM. P.TianL.MateraG. A. (2009). Reduced viability, fertility and fecundity in mice lacking the Cajal body marker protein, coilin.PLoS One4:e6171. 10.1371/journal.pone.0006171
226
WangL. C.WuJ. R.HsuY. J.WuS. J. (2015). Arabidopsis HIT4, a regulator involved in heat-triggered reorganization of chromatin and release of transcriptional gene silencing, relocates from chromocenters to the nucleolus in response to heat stress.New Phytol.205544–554. 10.1111/nph.13088
227
WangL.LiM.CaiM.XingJ.WangS.ZhengC. (2012). A PY-nuclear localization signal is required for nuclear accumulation of HCMV UL79 protein.Med. Microbiol. Immunol.201381–387. 10.1007/s00430-012-0243-4
228
WeisB. L.KovacevicJ.MissbachS.SchleiffE. (2015). Plant-specific features of ribosome biogenesis.Trends Plant Sci.20729–740. 10.1016/j.tplants.2015.07.003
229
WenD.WuJ.WangL.FuZ. (2017). SUMOylation promotes nuclear import and stabilization of polo-like kinase 1 to support its mitotic function.Cell Rep.212147–2159. 10.1016/j.celrep.2017.10.085
230
WenW.MeinkothJ. L.TsienR. Y.TaylorS. S. (1995). Identification of a signal for rapid export of proteins from the nucleus.Cell82463–473. 10.1016/0092-8674(95)90435-2
231
WieseA. J.SteinbachováL.TimofejevaL.ÈermákV.KlodováB.GanjiR. S.et al (2021). Arabidopsis bZIP18 and bZIP52 accumulate in nuclei following heat stress where they regulate the expression of a similar set of genes.Int. J. Mol. Sci.22:530. 10.3390/ijms22020530
232
XiaC.TaoY.LiM.CheT.QuJ. (2020). Protein acetylation and deacetylation: An important regulatory modification in gene transcription (Review).Exp. Ther. Med.202923–2940. 10.3892/etm.2020.9073
233
XiaoC.HuS.JansD. A. (1997). SV40 large tumor antigen nuclear import is regulated by the double-stranded DNA-dependent protein kinase site (Serine 120) flanking the nuclear localization sequence.J. Biol. Chem.27222191–22198. 10.1074/jbc.272.35.22191
234
XieD.ChenM.NiuJ.WangL.LiY.FangX.et al (2021). Phase separation of SERRATE drives dicing body assembly and promotes miRNA processing in Arabidopsis.Nat. Cell Biol.2332–39. 10.1038/s41556-020-00606-5
235
YamaguchiR.NakamuraM.MochizukiN.KayS. A.NagataniA. (1999). Light-dependent translocation of a phytochrome B-GFP fusion protein to the nucleus in transgenic Arabidopsis.J. Cell Biol.145437–445. 10.1083/jcb.145.3.437
236
YangX. J.SetoE. (2008). Lysine acetylation: Codified crosstalk with other posttranslational modifications.Mol. Cell31449–461. 10.1016/j.molcel.2008.07.002
237
ZhaoL. J.SubramanianT.ZhouY.ChinnaduraiG. (2006). Acetylation by p300 regulates nuclear localization and function of the transcriptional corepressor CtBP2.J. Biol. Chem.2814183–4189. 10.1074/jbc.M509051200
Summary
Keywords
nucleoplasm, nucleolus, stress, localization signals, non-coding RNAs, nuclear boodies
Citation
Muñoz-Díaz E and Sáez-Vásquez J (2022) Nuclear dynamics: Formation of bodies and trafficking in plant nuclei. Front. Plant Sci. 13:984163. doi: 10.3389/fpls.2022.984163
Received
01 July 2022
Accepted
04 August 2022
Published
23 August 2022
Volume
13 - 2022
Edited by
Ming Luo, South China Botanical Garden (CAS), China
Reviewed by
Yuda Fang, Shanghai Jiao Tong University, China; Kentaro Tamura, University of Shizuoka, Japan
Updates

Check for updates
Copyright
© 2022 Muñoz-Díaz and Sáez-Vásquez.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Eduardo Muñoz-Díaz, eduardo.munoz-diaz@univ-perp.frJulio Sáez-Vásquez, saez@univ-perp.fr
This article was submitted to Plant Cell Biology, a section of the journal Frontiers in Plant Science
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.